KEGG   Rhodococcus aetherivorans: AAT18_12200Help
Entry
AAT18_12200       CDS       T03876                                 

Definition
(GenBank) polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
rav  Rhodococcus aetherivorans
Pathway
rav00010  Glycolysis / Gluconeogenesis
rav00520  Amino sugar and nucleotide sugar metabolism
rav01100  Metabolic pathways
rav01110  Biosynthesis of secondary metabolites
rav01120  Microbial metabolism in diverse environments
rav01130  Biosynthesis of antibiotics
rav01200  Carbon metabolism
Module
rav_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
rav_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AAT18_12200
   00520 Amino sugar and nucleotide sugar metabolism
    AAT18_12200
Enzymes [BR:rav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     AAT18_12200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AKE89875
UniProt: A0A059MRQ0
LinkDB All DBs
Position
complement(2644931..2645716)
Genome map
AA seq 261 aa AA seqDB search
MTQTMHPATPDPDLLGFGVDVGGSGIKGGVVDLSTGRLVGERIKILTPQPSTPQAVADTV
ARIVDEAQWTGPVGVTLPSVVTGGVARTAANIDPAWIGTDARTLFSSVLGDRPVSVLNDA
DAAGLAEDRFGAAKDASGVVILLTFGTGIGSAVLHNGDLLPNTEFGHMEIDGMEAEHRAA
SSVKENNEWTYKRWAKEVSLVLSRFEALLWPDLFIAGGGISRKHEKWIPLLTNRTPVVPA
ALRNAAGIIGAAYAAKTGVLP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagacgatgcacccggccacgccggacccggaccttctcggattcggtgtcgac
gtcggcggcagcggcatcaagggcggcgtcgtcgatctgtccacaggccggttggtgggc
gagcgcatcaagatcctgaccccgcagccgtccaccccgcaggccgtcgccgacacggtc
gcccggatcgtggacgaggcgcagtggacgggaccggtgggggtcaccctgccgagcgtg
gtgacgggcggcgtggcgcgcacggccgcgaacatcgatccggcgtggatcggcaccgac
gcccggacgttgttctcgtcggttctgggcgaccgcccggtgagtgtcctgaacgacgcg
gacgccgccggcctcgccgaggaccgcttcggcgcggccaaggacgcgtccggggtggtc
atcctgctcacgttcgggaccgggatcggctcggcggttttgcacaatggcgatctgctg
ccgaacaccgagttcgggcacatggagatcgacgggatggaggccgagcaccgcgcggcg
tcgtcggtcaaggagaacaacgagtggacgtacaagcggtgggcgaaggaggtctcgctg
gtgctgtcgcggttcgaggccctgttgtggcccgacctgttcatcgccggtggcgggatc
agccgcaagcacgagaagtggatcccgttgctgaccaaccgcacacccgtcgttccggcc
gcattgcgcaacgcggccggcatcatcggggccgcctacgctgcgaaaacaggtgtactc
ccctga

DBGET integrated database retrieval system