KEGG   Rhodococcus aetherivorans: AAT18_14435Help
Entry
AAT18_14435       CDS       T03876                                 

Definition
(GenBank) polyketide synthase
Organism
rav  Rhodococcus aetherivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Acyl_transf_1 KR Ketoacyl-synt_C PS-DH KAsynt_C_assoc PP-binding adh_short Thiolase_N Epimerase Docking GDP_Man_Dehyd Polysacc_synt_2 3Beta_HSD NmrA NAD_binding_4 Shikimate_DH NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: AKE90242
LinkDB All DBs
Position
complement(3181812..3192371)
Genome map
AA seq 3519 aa AA seqDB search
MADDAKLLDYLKRVTAELYQAREKLREVEGVSREPIAVVGMGCRFPGGVRSPQDLWRLVE
SGSETVSGFPTDRGWEAADLYDPTGRQAGRTYTVQGSFLDDAAGFDPEVFGISPREALAM
DPQQRLLLETSWETFEHAGIDPRSVHGRQIGVFTGLSGIDYSARAGGAPPEELAGYFITG
TAMSVASGRVAYSFGLNGPAITVDTACSSSLVSVHLAMQALRNGECELALAGGATVMSTP
AVFVEFSRQRGLAHDGRCKAFSAAADGTAWGEGAAILALERLSDAERNDRRILAVVRGSA
VNQDGASNGLTAPNKQAQERVIRQALTDAGLGPADVDAVEAHGTGTTLGDPIEASALLAG
YGRDRPPDRPLWLGSVKSNLGHTQAAAGVAGVIKMIMAMRHGVLPRTLHVDRPTPHVDWS
AGSVSLLTENREWPATDRPRRAAVSSFGISGTNAHVVLERPAPPPDAAPTDGIDGSDDVV
AWFVSGHTEPALRAQAHRLRDYVADHPELTPAQVAGPLLTSRATFDHRAAVLGTDRTALL
SGLDALGRGAPDPGVITGVAVEAGDRPVFVFPGQGAQWVGMATELLESSPVFADSLRECA
DALAPHTGFALLDVLRDRDPAALDRADVVQPALFAVLVGLARLWHAHGVEPAAVVGHSQG
EIAAAHVAGALTLPDAALVVAARSRVITESARRGGGMASVGLPADAVRQQIEPWAGTVEV
AAINGPAATVVSGPGDALEVLVARWQADGVQARRITVDYASHCADVSVLRRPILDALAPI
TPQRSRIPFYSTVSGDMMDGTALDADYWYRNLRRPVRFEDATRSLARDGYRLFVESGSHP
VLTVPLQETLDAAGIAGRALGTLRRDRAGLRQFTTALAEAHVSGAHIEWDRVGWARRAGH
RPWVDLPTYAFQHRRYWLDGGAPQRDAAAAGMDAGDHPMLAASVELGDGRGAVFTGVLSP
HRLPWLNEHAVDGTVVLPGTAFVELALHAGHRSGCSRLAELTLETPAPVPTGGELAVQVA
VLTADDAGHRTVSVHSRPADAPARTPWTRHAVGALTGAVHTAQVPIRQWPPADATPIDVS
GLYDALDETGYGYGTVFRGLRAAWRRGDDLYGEVRLGGEDPAAAVAGYGIHPAVFDAALH
LIAFAAAEAGARDLRLPFAWDDVQLHAVGATALRVHIAPAGPERYRVAAYDTAGKPVLTA
RSLALRPFAGPRAPAAATGTGLYRVEWIPVEAGAAPTADLAALGEALTGGDPAGRTLLLA
GEPDDESDVPTRAHAAAEAALRAVQAWLADERLAETRLLVTTGRAVAVTDDEPIDVGAAP
VWGLIGAVQNEHPDRITLVDLDRPPGDLPDPTVLSAALACDEPQLAVRAGTLLAPVLAAV
PTATDAAADPVPFGPDGTVVVTGGTGTIGRLVARHLVRRYGVRRLVLTGRHAVRAERATD
LRAEFAEAGAEIRAVTCDVADRAAVAALLDAVPDLSGVVHAAGVLDDATAATLTPDQLHA
VLRPKVDGAWHLHELTRDRGLAAFVLFSSAAGVLGGAGQANYAAANVFLDALAQHRRAEG
LPGLSLAWGLWDRPSGMTSHLNAADLDRLQRTGIDTLTPEAGLALFDAALAANRPLTVPI
RLSAPARRSDGEALPPILRRVLGTSRRRAAAAPSAPGLADELRALDPAERHARVLEIVTT
HVAAVLGHDGKEAIDPERAFKQLGFDSLTAVQLRNQLTTATGVRLAATVVFDHPTADALA
REIAARLLGPEDTPQPTRTARRRHDDDPIAIVGMACRYPGQVSCPDELWRLVRDGRDAVG
AYPDNRGWNLDEVYHPDPERSGTTYMRAGGFLYDADRFDAAFFGISPREAVAMDPQHRLL
LESAWEALEYAGIPPNSPGLTDTGVYVGMMGGDYGFHLMTRRSTDAEGYLMTGTSNSVAS
GRIAYSLGFTGPAVTVDTACSSSLVALHLAARALRDGECTLALAGGATVMATPGVLIEFS
RQRGLAPDGRCKPFSDRADGTGLSEGAGMVVLERLSDAQRHGHRVLALIRGSAVNQDGAS
NGLTAPNGPSQERVIRQALADAALDPADIDAVEAHGTGTTLGDPIEAQALLATYGQQRDG
RPLWLGSVKSNIGHSQAAAGVAGVIKMVMAMRHGVLPPSLHSDAPTRHVDWTSGEVALLA
DAVAWPQTGRPRRAGVSSFGISGTNAHMILEQPPDVAAPAAPPRSASPLVWVLSAKTDEA
LRAQAARLTDVLDRDALDTGAPPDPADLAYSLATTRSGFTHRAAVTGETLADLRDGLARL
AEGRAGGNAVAGTSARGRTAFMFTGQGAQRIGMGRGLYDTYPVFARALDETCAALDEHVD
TPIRQVIWGDADEAAARLDRTEYTQPALFAVEVALYRLLREWGLTPDYLIGHSIGELTAA
HVAGVFSLPDAAALVAARGRLMQATAPGAMIAVRARPEDVRSRIDGRVDLAAVNGAESVV
LAGAAADVHAVAAELSTAGIAVTTLQVERAFHSALMDPVLDEFTTVVSRPAAQPPTIPVV
STLTGRVATAEELTSPQYWRRHIRRAVRFHDGMRTLAELGVSRCVEIGPGAALAAHAAEV
VPHPIATLPGRGDDARGFVEAVAAASVQGLAIDWDRVLPGRRRVDLPTYAFRRRSFWPSA
PARTSGDPTELGLSPADHPLLGAAVTLDDDTTVFTGALSRHRDSSLAAPQPGDPPTDAPQ
TLVPAVLVELTLHAAHHVGCDRIAALTLHHALGLPAAGSLPIRVLVSPAGEDGARTVTVS
SNMGPADGPWVRNASATVDDVLAAQPDRLPGDTTTEVRLDDGVDPSGFGIHPQLLQAALD
SVFGPDDWPLTWSGTRLHRTGAQAVSVRCATGEDGRYRVDATDADGAPVLTVEALHVVPR
TGDGDGAGPSGARRLHRLAWTRIDDLPSEPPPGPMVVLGAADLESSLSRCPDAAALRTAR
AATPDDGRPWTVLVGCGTDGDPGPEATHHLCARTLRLLQDWLDDAEFADSVLVVVTRNAT
ATGEEGEGVDIDLAAAAVWGLVGSAQNENPGRFVLLDLDRETDVDTAITSALASGEPQVA
VRGRAVLVPRLRRIPAVQRSGPLFDPRGTVLVTGGTGTVGGSVARHLVSTHGARHLVLTS
RRGPDADGSDRLRRELRDAGAEVRIVACDTADAAALAGLLARIPAEHPLTAVIHAAGVLD
DATLTSLTPDRLDAVLRPKVDAAWHLHRLTAGVHAFVLFSSLAGVLGAPGQGNYAAANRF
LDALAQHRRAHGRPAVSIAWGMWAPPSAMTGRLGAVDLARARRSGLVPMSEADGLDLFDS
ALASDLSAVVGARFEHLGAAATSVPAPLRGLVRQARPRAAGSGSALSGPNGSGPLEWAQR
LTDRSVPEQRHLVLELVRAGAAAVLGHDASDSVDPDQAFKELGFDSLAAVALRNHLGAAT
GLRLPPTVVFDHPSPRAVAEFLRAELVPDPVSVAVAGIDRLQAVVADLGADDEVRAAVAQ
RLEALLADLAGAERGRADTVDRIHAATGDEILDIIDRGL
NT seq 10560 nt NT seq  +upstreamnt  +downstreamnt
atggccgatgacgcgaagctcctcgactatctgaaacgggtgaccgcagagctctatcag
gcccgggagaagctccgcgaggtcgagggggtgagtcgcgaaccgatcgccgtcgtcggg
atggggtgccggttccccggcggcgtccgctccccacaggatctgtggcgcctggtggaa
tccggttcggagaccgtctccgggttccccacggaccggggttgggaagcggcggatctc
tacgatccgacgggccggcaggccggcaggacgtacacggtgcaaggtagctttctcgac
gatgcagcgggtttcgacccggaggtcttcggaatctcacctcgcgaagcactggcgatg
gatccgcagcagcgactcctgctcgagacgagctgggagaccttcgagcacgccggcatc
gatccgcggtccgtgcacggcaggcagatcggcgtcttcaccggtctgtccggaatcgac
tactcggcacgggcgggcggcgccccgcccgaggaactcgcgggctacttcatcaccggc
accgcgatgagtgtcgcctccggccgtgtcgcatacagcttcggactgaacggacccgcg
atcaccgtcgacacggcatgctcgtcgtccctggtgtccgtccacctcgccatgcaggca
ctgcgcaacggcgagtgcgaactcgccctggccggcggggcgaccgtcatgtcgacgccc
gcggtgttcgtcgagttcagccggcagcgtggactggcccacgacgggcgctgtaaggcg
ttctccgccgcggccgacggtacggcgtggggcgaaggcgccgcgatcctcgcgctggaa
cgcctgtccgacgccgagcgcaacgaccgccggatcctcgccgtcgtccgcggtagcgcg
gtgaaccaggacggcgccagcaacggcctgaccgccccgaacaagcaggcccaggaacgg
gtgatccggcaggccctgaccgacgccggactcggcccggccgacgtcgacgcggtcgaa
gcccacggcaccggcaccacgctgggcgatcccatcgaggcgtccgccctgctggccggc
tatggccgcgatcggccccccgaccggccgttgtggctcggctcggtgaagtcgaacctc
gggcacacccaggcagccgccggagtggccggagtgatcaagatgatcatggcgatgcgg
cacggtgtgctgccgagaacgctgcacgtcgaccgccccaccccccacgtcgactggtcc
gccggatcggtgtccctgctcaccgagaaccgggaatggccggcgaccgaccggccccgc
cgggcggcggtctcctcgttcggcatcagcggcacgaacgcccacgtcgtgctggagcgg
ccggccccaccgccggacgctgcgcccaccgacgggatcgacggatcggacgacgtcgtg
gcctggttcgtgtcgggccacaccgaaccggcgctgcgtgcgcaggcccacaggctgcgg
gactacgtcgccgaccaccccgagctgacacccgcccaggtggccggcccgctgctgacc
tcccgcgcgaccttcgaccaccgtgccgccgtgctcggtaccgaccggacggccctgctg
tccggtctcgacgcgctcggccgaggcgcccccgaccccggtgtgatcaccggcgtggcg
gtcgaggcgggcgaccggccggtgttcgtctttcccgggcagggcgcgcaatgggtgggc
atggccaccgaactgctggagtcctccccggtgttcgccgacagcctgcgcgagtgcgcc
gacgccctggccccgcacaccgggttcgcgctgctcgacgtgctccgcgaccgcgatccg
gcggccctggaccgggccgacgtcgtgcaacccgcgctgttcgcggtgctggtcggtctt
gcgcggctgtggcacgcacacggcgtcgaaccggcggccgtggtcgggcactcgcagggc
gagatcgccgccgcccacgtcgccggcgcgctgaccctgcccgacgcggcgctcgtcgtc
gcggcccgcagccgggtgatcacggaatcggcccggcgcggcggtggcatggcgtcggtg
ggtctgccggcggacgcggtgcggcagcagatcgaaccctgggccgggaccgtcgaggtg
gcggcgatcaacggtccggccgccacggtcgtgtccggccccggcgacgccctcgaggta
ctggtcgcgcggtggcaggccgacggtgtccaggcccggcgcatcaccgtcgactacgcc
tcccactgcgcggacgtctcggtgctgcgcaggcccattctcgacgctctcgccccgatc
accccgcagcgttcgcggatcccgttctactcgacggtgagcggggacatgatggacggc
accgcactcgacgccgactactggtaccggaacctgcgccggccggtgcgcttcgaggac
gcgacgagatctctggcccgcgatgggtatcggctgttcgtcgagtcggggagccatccg
gtcctgaccgtgccgctgcaggagaccctggacgcggccggcatcgcgggtcgcgccctc
ggcaccctccggcgcgaccgggcaggcctacgccagttcaccaccgccctcgccgaggca
cacgtgtccggggcgcacatcgagtgggaccgggtcgggtgggctcgccgcgccggtcac
cggccgtgggtggacctgcccacgtatgccttccagcatcgccgctactggctcgacggg
ggcgcgccgcaacgtgatgccgccgcagccggcatggatgccggggaccacccgatgctc
gccgcctcggtcgaactcggcgacggtcgcggcgcggtgttcacgggcgtgctgtcgccg
caccgactgccgtggctgaacgagcacgctgtggacggcaccgtggtgctgcccggcacg
gcgttcgtcgaactcgccttgcacgccgggcatcgctccggctgcagccgcctcgcggaa
ctcaccctcgagacgcccgcgccggttcccaccggtggggagctcgcggtgcaggtcgcc
gtcctcaccgccgacgacgccgggcaccgcacggtgtcggtgcactcccgcccggcggac
gccccggcgcggacaccgtggacccggcacgccgtcggcgcactcacgggcgcggtgcac
accgcgcaggttccgatccggcagtggcccccggccgatgcgacgccgatcgacgtgagc
ggtctgtacgacgcgctcgacgagaccggatacgggtacgggacggtcttccggggcctg
cgcgcggcgtggcgccgcggtgacgacctgtacggagaggtgcgcctggggggagaggac
cccgccgcggcggtcgccgggtacgggatccatccggcggtgttcgacgcggcgctgcac
ctgatcgcgttcgccgccgccgaggccggcgcccgcgacctgcgactgccgttcgcatgg
gacgacgtgcaactgcacgccgtgggtgccaccgccctgcgcgtacacatcgccccggcc
ggacccgaacggtaccgggtggccgcgtacgacaccgccggcaagcccgtgctgaccgcg
cgctcgctggcgctgcggccgttcgcaggtccgcgggcgccggccgccgcgaccggcacc
ggcctctaccgcgtggaatggatcccggtcgaggccggcgcggccccgacggcggacctc
gccgcgctcggggaggcactcaccggcggcgatcccgccggccgcaccctgctgctggcc
ggggaaccggacgacgaatccgacgtgccgacgcgcgcgcacgccgccgcggaggcggcg
ttgcgggcggtacaggcctggctcgccgacgagcggctcgccgagacccgactgctggtg
acgacgggccgcgccgtggcggtcaccgacgacgaaccgatcgacgtcggcgccgcgccc
gtgtgggggctgatcggtgccgtgcagaacgaacacccggaccggatcaccctggtggac
ctggaccggccgcccggtgacctgcccgatcccaccgtgctgtccgcggccctggcctgc
gacgaaccacaactggcggtccgcgccgggacactcctcgcgcccgtgctcgcggcggtg
ccgaccgccaccgacgcagccgcggatccggtgccgttcggccccgacggcaccgtcgtc
gtcaccggcggcaccggaaccatcggccggctcgtcgcccgtcacctcgtgcggcggtac
ggggtgcgccggctcgtgctgaccggccgacacgcggtccgcgccgagcgggcgacggac
ctgcgcgccgagttcgccgaggcgggcgccgagatccgcgccgtgacctgcgacgtggcc
gatcgagccgcggtggcggccctgctcgacgccgtccccgacctgtcgggtgtcgtccac
gccgccggggtgctcgacgacgccaccgccgccaccttgactccggaccagttgcacgcc
gtcctgcgccccaaggtggacggtgcgtggcatctgcacgagctcacccgcgatcgcggt
ctcgcggcgttcgtgctgttctcctccgcggcgggtgtgctcggcggcgccggccaggcg
aactacgcggcggccaacgtcttcctcgacgcgctcgcgcagcaccgccgcgccgaggga
ctgccgggactgtccctggcctggggactgtgggaccgccccagcgggatgacctcccat
ctgaatgcggccgatctggatcggctccagcgcaccggcatagacaccctcacccccgaa
gcggggctggccctgttcgatgcggcgctcgccgcgaaccgtccgttgacggtgccgata
cggctctcggcgcccgcccgccgctccgacggcgaggccctccccccgatcctgcgccga
gtgctcggcacgtcccgtcggcgcgccgcggccgccccgtcggcccccggcctcgccgac
gaactgcgggcgctcgaccccgccgagcggcacgcccgggtcctcgaaatcgtcaccacg
cacgtcgcggccgtactcggccacgacgggaaggaggccatcgatccggaacgggccttc
aagcaactcggcttcgactcgctcaccgcggtgcagctacgcaaccagctgacgacggcc
accggggtgcggctggccgcgacggtggtgttcgaccaccccaccgcggacgcgctcgcc
cgcgagatcgcggcacggctgctcggccccgaggacaccccgcaaccgacccgcacggcg
cgccggcgccacgacgacgacccgatcgcgatcgtggggatggcctgccgataccccggc
caggtctcctgcccggacgagctgtggcgcctcgtccgcgacggccgcgacgcggtgggc
gcgtaccccgacaaccgcggctggaacctcgacgaggtgtaccacccggatcccgagcgc
agcggcacgacctacatgcgggccggcggattcctctacgacgccgaccggttcgacgcc
gcgttcttcgggatcagcccccgcgaggccgtcgcgatggatccgcagcaccgactgctg
ctcgaaagcgcctgggaagcactggaatacgcgggaatcccgccgaactcgcccgggctc
accgacaccggcgtgtacgtcggaatgatgggcggcgactacggattccacctcatgacc
cggcggagcaccgacgccgagggctacctcatgacgggcaccagcaacagcgtggcctcc
gggcggatcgcctactcgctcggcttcaccggtcccgcggtcaccgtcgacacggcgtgt
tcgtcgtccttggtggcgctgcacctggcggcgcgggccctgcgcgacggcgaatgcacc
ctcgcgctggccggtggggcgacggtgatggcgacccccggcgtgctgatcgaattcagc
cgccagcgcggactcgccccggacgggcggtgcaaaccgttctccgatcgagcggacggc
accgggctcagcgagggcgcgggcatggtcgtgctcgagcggctgagcgacgcccagcgc
cacggccaccgggtgctggcactgatccgcggctccgcggtcaatcaggacggcgcttcg
aatggcctgaccgccccgaacggtccgtcgcaggaacgggtgatccggcaggcgctggcc
gacgctgccctcgaccccgccgacatcgacgcggtggaggcccacggcaccggcacgaca
ctcggcgacccgatcgaagcccaggcgttgctggccacctacgggcagcaacgcgacggc
cggccgctgtggctggggtcggtcaagtcgaacatcggccactcccaggcggcggccggg
gtggccggcgtgatcaagatggtgatggcgatgcgacacggtgtgctgccgccgagcctg
cacagcgacgccccgacccggcacgtcgactggacctccggcgaggtcgcgctgctcgcc
gacgcggtggcatggccgcagaccgggcgcccccgccgcgccggcgtctcctcgttcggc
atcagcggcaccaacgcccacatgatcctcgagcagccgcccgacgtcgccgcaccggcg
gccccgccgcggtcggcgtcgcccctggtgtgggtgctctccgccaagaccgacgaggcg
ctgcgcgcgcaggccgcccggctgacggacgtcctcgacagggacgccctcgacacgggg
gccccgccggatccggccgatctcgcctactcgctggccaccacccggtccggcttcacg
caccgcgccgccgtgaccggcgagacgctcgccgacctacgcgacggcctggcccgcctc
gccgagggacgcgcaggcggcaacgccgtcgccgggacgagcgcccgcgggaggacggca
ttcatgttcaccggccagggcgcgcagcggatcggaatgggccgcggcctctacgacacc
tacccggtgttcgcccgggccctggacgagacctgcgccgccctcgacgagcacgtcgac
accccgatacggcaggtgatctggggcgacgcggacgaagccgccgcgagactcgaccgc
accgagtacacccagccggccctgttcgccgtcgaggtcgccctctaccgactactgcgg
gaatggggcctcacccccgactacctgatcggacattcgatcggagaactcaccgcggcc
cacgtcgcgggcgtgttcagcctgcccgacgccgccgccctggtggccgcgcgcggacgg
ctgatgcaggccaccgcccccggggcgatgatcgccgtccgggcccgcccggaggacgtc
cggtcgcggatcgacggccgagtcgaccttgccgcggtgaacggcgccgaatccgtggtg
ctcgcgggagctgcagccgacgtgcacgccgtcgccgccgaactgtccaccgcgggaatc
gcggtcaccacgctgcaggtcgaacgcgcgttccattcggcgctgatggaccccgtcctc
gacgagttcaccaccgtcgtgtcgcggccggcggcgcagccgccgacgatccccgtcgtc
tccactctcaccgggcgcgtcgccacggccgaggaactgacgtcgccgcagtactggcgc
cggcacatccgccgagccgtgcgcttccacgacggcatgcgcaccctcgccgaactcggc
gtctcccgctgcgtcgagatcggacccggcgcggccctggccgctcacgctgccgaggtc
gtcccgcacccgatcgccacattgcccgggcgcggggacgacgcacggggcttcgtcgag
gcggtcgccgctgcgtccgtgcagggcctggcgatcgactgggatcgggtactgcccggc
cgccgccgggtggacctgcccacgtacgccttccggcgtcgctccttctggccgtcggcg
cccgcacgcaccagcggtgatccgacggagttggggttgagcccggcggaccatccgctg
ctcggcgcggccgtgaccctcgacgacgacaccaccgtgttcaccggagcgctgtcccgg
caccgggattcgtcgctcgcggcgccgcagcccggcgatccgccgaccgacgctccgcag
accctggtaccggccgtcctggtcgagctgaccctgcacgccgcccaccacgtcgggtgc
gaccgcatcgccgctctcacgctgcaccacgcgctgggcctgccggccgcggggtcgctg
ccgatccgggtgctcgtgtcaccggccggtgaggacggcgcgcgcaccgtcaccgtctcg
tcgaacatgggaccggccgacggcccctgggtgcggaacgcgtcggcgaccgtcgacgac
gtgctcgccgcgcagccggaccggctcccgggcgacaccacgaccgaggtgcgcctcgac
gacggcgtcgacccgagcggcttcgggatccatccgcaactgctgcaggcggcgctcgac
tccgtcttcgggccggacgactggccgctgacctggtcgggaacccggctgcaccgcacc
ggtgcgcaggcggtgtcggtgcggtgcgcgacgggcgaggacgggcggtaccgcgtcgac
gccaccgatgccgacggcgcgccggtgctgaccgtcgaggcgctgcacgtggtgccccgg
acgggcgatggggacggcgcgggcccgtccggcgcgcggcgactgcaccgcctggcatgg
acccgaatcgacgacctcccgtccgagccgccgcccggcccgatggtggtactcggcgcc
gcggatctggaatcgagcttgtcgcgctgtcccgacgcggcggcgctgcgcaccgcgagg
gcagccacgcccgacgacgggcggccctggacggtgctggtggggtgcggcaccgacggc
gacccgggcccggaggcgacccaccacctgtgcgcccggacgctgcgactgctgcaggac
tggctcgacgacgccgagttcgccgacagtgtgctggtggtcgtcacccgcaacgcgacg
gccaccggcgaggagggcgaaggggtcgacatcgacctcgcggccgccgccgtgtggggt
ctggtgggctccgcgcagaacgagaaccccgggcggttcgtgctgctcgacctcgaccgg
gagacggacgtcgacacggcgatcacgtcggccctggccagcggggaaccgcaggtcgcg
gtccggggccgggccgtgctcgtgccccgcctgcggcgcataccggccgtgcagcgatcc
ggtccgctgttcgacccccgcggcaccgtgctcgtcaccggcggcaccggcaccgtggga
gggtcggtggcgcgccatctcgtcagcacgcacggggcgcggcatctggtgctgaccagc
cgacgcggacccgacgccgacggaagcgaccggctacgccgcgaactgcgcgatgcgggc
gccgaggtgcgcatcgtcgcctgcgacaccgccgacgcggcggcactggccggtctgctg
gcccggatccccgccgagcaccccctgaccgcggtgatccacgcggccggagtcctcgac
gacgccaccctcacctcgctcacccccgaccggctcgacgcggtgctgcggccgaaagtc
gacgcggcctggcacctgcaccggctgaccgccggggtccacgccttcgtgctgttctcg
tcgctcgccggtgtgctcggcgcgcccgggcagggcaactacgcagcggcgaaccggttc
ctcgacgccctcgcccagcatcggcgagcccacggccggcccgcggtctcgatcgcgtgg
ggcatgtgggcaccgccgagcgccatgaccggcaggctcggcgcggtggatctcgcccgg
gcccgccgtagcggcctggttccgatgagcgaggccgacggcctggacctgttcgacagc
gccctggcgtccgacctctccgccgtggtgggggctcggttcgagcacctcggtgcggcc
gcgacgtccgttcccgctccgctgcggggactggtgcggcaagcgcggccgcgcgcggcc
ggctcggggtcggcgttgtccggaccgaacggatcagggccgttggagtgggcgcagcgg
ctcacggaccggtcggtgcccgaacagcggcacctcgtgctggagctggtgcgagccgga
gctgccgcagtcctcggccacgacgcgtcggactcggtcgatcccgaccaggcgttcaag
gaactcggcttcgactcgctcgcggcggtggccttgcgcaaccatctcggtgccgcgacc
ggtctgcggttaccgccgacggtggtgttcgatcaccccagtccccgggccgtcgccgag
ttcctgcgcgcggagctggtcccggacccggtgtcggtggccgtcgccgggatcgaccgc
ctgcaggcggtcgtcgccgacctcggcgccgacgacgaggtacgcgcggcggtcgcgcag
cggctcgaagccctgctcgccgacctcgcgggagccgagcggggccgcgccgacacggtg
gacaggattcacgccgcgaccggtgacgagatcctcgacatcatcgaccggggtctgtga

DBGET integrated database retrieval system