KEGG   Rhodococcus aetherivorans: AAT18_17705Help
Entry
AAT18_17705       CDS       T03876                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
rav  Rhodococcus aetherivorans
Pathway
rav00020  Citrate cycle (TCA cycle)
rav00480  Glutathione metabolism
rav01100  Metabolic pathways
rav01110  Biosynthesis of secondary metabolites
rav01120  Microbial metabolism in diverse environments
rav01130  Biosynthesis of antibiotics
rav01200  Carbon metabolism
rav01210  2-Oxocarboxylic acid metabolism
rav01230  Biosynthesis of amino acids
Module
rav_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rav_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:rav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AAT18_17705
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AAT18_17705
Enzymes [BR:rav01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     AAT18_17705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AKE90765
UniProt: A0A059MPB2
LinkDB All DBs
Position
complement(3907211..3908428)
Genome map
AA seq 405 aa AA seqDB search
MSKIKVEGTVVELDGDEMTRIIWQFIKDKLIHPYLDVNLEYYDLGIEHRDATDDQVTVDA
ANAIKKHGVGVKCATITPDEARVEEFGLKKMWRSPNGTIRNILGGTIFRAPIIISNVPRL
VPGWTKPVIVGRHAFGDQYRATDFKVDRPGTVTITFTPEDGSEPIQHEVCHIPEDGGVVM
GMYNYKKSIQDFARASLSYGLQQNYPVYLSTKNTILKAYDGMFKDEFQRIFEEEFKAEFD
AAGLTYEHRLIDDMVASSLKWEGGYVWACKNYDGDVQSDTVAQGYGSLGLMTSVLMTPDG
RTVEAEAAHGTVTRHFRQHQAGKPTSTNPIASIFAWTRGLEHRGKLDNTPEVIDFAQQLE
DVVIKTVEAGQMTKDLALLIGPEQAWLTTEEFLAALDENLQKARA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagatcaaggttgaaggaacggtcgtcgaactcgacggcgacgagatgacccgc
atcatctggcagttcatcaaagacaagctgatccatccctacctggatgtgaatctcgag
tactacgacctcggcatcgagcaccgcgatgcaaccgacgaccaggtcaccgtcgacgca
gccaacgccatcaagaagcacggcgtcggcgtcaagtgcgccaccatcactcccgacgag
gcccgggtcgaggagttcggcctgaagaagatgtggcgctcgcccaacggcacgatccgt
aacatcctgggcggcaccatcttccgtgccccgattatcatctccaacgtgccccgcctg
gtgcccggctggaccaagccggtcatcgtcggccgtcacgccttcggtgaccagtaccgc
gccaccgacttcaaggtcgaccgcccgggcaccgtcaccatcaccttcacgccggaggac
ggcagtgagccgatccagcacgaggtgtgccatatccccgaggacggcggcgtcgtcatg
gggatgtacaactacaagaagtccatccaggacttcgcgcgggcctcgctgtcctacggt
ctgcagcagaactacccggtctacctctccaccaagaacacgatcctcaaggcctacgac
ggcatgttcaaggacgagttccagcggatcttcgaggaagagttcaaggccgagttcgat
gccgcgggcctgacctacgagcaccgcctcatcgacgacatggtcgcctcctcgctcaag
tgggagggtggctacgtctgggcctgcaagaactacgacggcgacgtccagtccgacacc
gtcgcgcagggctacggctcgctgggcctgatgacgtccgtgctcatgaccccggacggc
aggaccgtcgaggccgaggccgcgcacggaaccgtcacccggcacttccggcagcatcag
gcgggcaagccgacgtcgaccaacccgatcgcgtcgatcttcgcctggacccgtggcctc
gagcaccgcggcaagctcgacaacacccccgaggtcatcgacttcgcgcagcagctcgag
gacgtcgtcatcaagaccgtcgaagcgggacagatgaccaaggacctcgccctgctcatc
ggccccgagcaggcatggctgaccaccgaggagttcctcgccgcgctcgacgagaacctc
cagaaggcccgcgcctga

DBGET integrated database retrieval system