KEGG   Rhodococcus aetherivorans: AAT18_22540Help
Entry
AAT18_22540       CDS       T03876                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
rav  Rhodococcus aetherivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AKE91560
LinkDB All DBs
Position
5035217..5036665
Genome map
AA seq 482 aa AA seqDB search
MTDYDKLFIGGRWVAPSTDERLEVFSPATEERVGSVPVAGPADIDAAVAAARAAFDDGPW
PRTSPSERAQVLAKAAKLLEERSADLAASLSAEMGQPPASVQMMQVTPSLATINYYAGLA
DSFPWTEERTGAFGRSRVTREPVGVVAAVIAWNVPLFLMINKLGPALLAGCTVVLKPAPE
SPLTANAVAEIFAEAGLPEGVLSLVPGGAETGEYLVSHPDIDKITFTGSTAVGKHIGEIA
ARNLKRCSLELGGKSAAIVLEDADLDSTVAMLVMSGLMNTGQACVGQTRILAPRSRYDEV
VEKMVATAAFFPVGMPDDAAAQLGPLISAKQRDRVEGYIAKGTEEGARLVLGGGRPAGLD
KGWFVEPTIFADVDNSMTVAREEIFGPVLCVIPYDSVDEAVEIANDSDYGLAGSVYTTDV
EKGLEVASRVRTGTYGINWYAFDPGSPFGGYKNSGIGRENGPEGLEAFCETKSVLYPPGY
GA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgaccgactacgacaagctgttcatcggcggccgctgggtcgccccgtcgaccgacgag
cgactcgaggtgttctcaccggccaccgaggaacgcgtcggttcggtgccggtcgccggg
ccggcggacatcgacgccgccgtcgccgcggcccgtgccgccttcgacgacggaccgtgg
ccccgcacctcaccgtccgagcgggcccaggtactcgccaaggccgccaagctgctcgag
gagcgcagcgccgacctcgccgcgtcgctgtccgccgagatgggtcagccgcccgcctcc
gtgcagatgatgcaggtgacgccgtccctggcgaccatcaactactatgcgggacttgcc
gattcgttcccgtggacggaggagcgcaccggggccttcggacgctcccgggtgacgcgc
gaacccgtcggcgtggtcgccgccgtcatcgcctggaacgtgccgctgttcctgatgatc
aacaagctcggcccggccctgctcgccggctgcaccgtggtcctcaagcccgcgcccgag
tcgccgctgaccgccaacgcggtcgcggagatcttcgccgaggccgggctgcccgagggc
gtgctgtcgctcgtcccgggcggcgccgagaccggcgagtacctcgtctcgcaccccgac
atcgacaagatcaccttcaccggctcgaccgccgtcggcaagcacatcggcgagatcgcg
gcccggaacctcaagcgctgctccctcgagctcggcggcaagtccgccgccatcgtcctc
gaggacgccgacctcgactcgaccgtcgcgatgctcgtgatgtcgggcctgatgaacacc
gggcaggcctgcgtcggccagacccgcatcctggcgccgcgctcgcgctacgacgaggtc
gtcgagaagatggtggcgaccgcggccttcttccccgtcggcatgcccgacgacgcggcg
gcgcaactcgggccgctgatctccgcgaagcagcgcgaccgcgtcgagggctacatcgcc
aagggcacggaggagggcgcgcggctggtgctcggcggcggccggcccgccgggctcgac
aagggctggttcgtcgagccgacgatcttcgccgacgtcgacaactccatgaccgtcgcg
cgcgaggagatcttcggtcccgtgctgtgcgtgatcccctacgacagcgtcgacgaggcc
gtcgagatcgccaacgactccgactacggcctcgccggctcggtgtacaccaccgacgtc
gagaagggcctcgaggtggcgtcgcgggtgcgcaccggcacctacggcatcaactggtac
gccttcgacccgggctcgccgttcggcggctacaagaattccggcatcggccgggagaac
ggccccgagggcctcgaggcgttctgcgagaccaagtcggtgctgtacccgcccggctac
ggcgcctga

DBGET integrated database retrieval system