KEGG   Rhodococcus aetherivorans: AAT18_23215Help
Entry
AAT18_23215       CDS       T03876                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
rav  Rhodococcus aetherivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AKE91668
LinkDB All DBs
Position
complement(5179391..5180458)
Genome map
AA seq 355 aa AA seqDB search
MQLPVAPPIAPMLAKAVSEVPAQPADGDPEWSYEPKWDGFRAVVFRDGDEVVFASRGGKD
LVRYFPELAAAVRAELPARCVVDGEIVVPRPRDGRIRLDWQALSERIHPAASRIALLAEQ
TPAQFVGFDLLAIGDENLMEAPFARRRERLRAVVGGGPSCHVTAATRDPDTAGRWFAEFE
GAGLDGVVAKRLDGPYVPDKREMLKVKHARTADCVLIGYRPHKSIDGVGSLLLGLYDGGD
EPVMVGGASAFTVEQRKELLAELAPLRVGADVVAEGEPSRWRTAVDRRWIPLRPERVLEV
AYDQMEGNAETGLRFRHAARFLRWRPDREPRSCTFEQLDVPVRYDLGDVLDRTGV
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
gtgcagctgcccgtcgctccgccgatcgcaccgatgctcgccaaggccgtgtccgaggtc
ccggcccagcccgccgacggcgaccccgagtggtcgtacgagccgaaatgggacggcttc
cgcgccgtcgtgttccgcgacggcgacgaggtggtgttcgcctcgcgcggcggcaaggac
ctcgtgcggtacttcccggaactggcggcggcggtgcgggccgagttgcccgcccggtgc
gtcgtcgacggtgagatcgtggtgccgcgcccgcgcgacggccggatccggctcgactgg
caggcgctgtccgagcgaatccacccggcggcgagccgcatcgcgttgctcgccgagcag
acccccgcgcagttcgtcggcttcgatctgctcgcgatcggtgacgagaacctgatggag
gcgccgttcgcgcggcgcagggagcggctgcgggcggtggtcggcggcggccccagctgc
cacgtcacggccgccacccgcgacccggacaccgccggccggtggttcgccgagttcgag
ggtgccggtctcgacggggtcgtcgccaagcgtctcgacgggccctatgtgccggacaag
cgggagatgctcaaggtcaagcacgcccgcaccgccgactgcgtgctcatcggctaccgg
ccgcacaagagcatcgacggggtcgggtccctgctgctgggcctgtacgacggcggcgac
gaaccggtgatggtgggcggtgcgtcggcgttcaccgtcgaacagcgcaaggagctgctc
gccgaactcgcaccgctgcgggtcggcgccgacgtcgtcgccgagggggagccgagccgg
tggcggacggcggtggaccgccgatggataccgctgcggccggagcgggtcctggaggtg
gcctacgaccagatggagggcaacgccgagaccggcctgcggttccggcacgcggcgcgg
ttcctgcggtggcgaccggaccgcgagccgcgcagctgcaccttcgagcagttggacgtg
ccggtgcggtacgacctcggcgacgtcctcgaccggacaggagtgtga

DBGET integrated database retrieval system