KEGG   Rhodococcus aetherivorans: AAT18_23980Help
Entry
AAT18_23980       CDS       T03876                                 

Definition
(GenBank) 2,3-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
rav  Rhodococcus aetherivorans
Pathway
rav00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:rav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AAT18_23980
Enzymes [BR:rav01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     AAT18_23980
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     AAT18_23980
    1.1.1.-  
     AAT18_23980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc FAD_binding_3 TrkA_N Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AKE91793
UniProt: A0A059MI75
LinkDB All DBs
Position
complement(5343367..5344422)
Genome map
AA seq 351 aa AA seqDB search
MKAARFHGPGDIRVEDVPEPATRPGTVKVEVEWCGICGTDLHEYLEGPIFAPPADAPHPI
TGETVPITLGHEFAGVVAEVGDGVDDVRVGDRVVVEPYIICGRCDACRNGRYNVCSTLGF
VGLSGYGGGFSQYVVAERRWIHPLGELGTDVGALVEPLAVAYHAVRLSGARPSHSALVFG
AGPIGLVTTSALRAAGVEQIIVVEPAEVRKKKAEPAGADHIIDPRDGDVTEQVLELTGGR
GADVSFECAGIDAVLKTAIQSTRAGGTCVNVAIWGHEASVAMNDLVFREVNLLGSLAYAN
DHPATIEMIASGKVDPYQFITGRIGLDDIVKDGFEELITNKEENVKILVQP
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagcccgcttccacggccccggggacatccgggtcgaggatgtccccgaaccg
gcgacccggcccggaaccgtcaaggtcgaggtcgagtggtgcggtatctgcggcaccgac
ctgcacgagtacctcgagggcccgatcttcgccccgcccgccgacgcaccgcaccccatc
accggcgagaccgtgccaatcaccctcggtcacgagttcgccggtgtcgtcgcggaagtg
ggcgacggcgtggacgacgtgcgggtgggcgaccgggtggtcgtcgagccgtacatcatc
tgcggccgctgcgacgcctgccgcaacggccgctacaacgtgtgcagcacactgggattc
gtgggcctgtccggatacggcggcggcttctcgcagtacgtcgtcgccgagcggcgctgg
attcatccgctcggcgaactcggcaccgacgtcggcgccctcgtcgaaccgctcgccgtc
gcgtaccacgccgtgcggctctcgggtgcgcggccgagccactcggcgctcgtgttcggg
gccgggccgatcgggctcgtcaccacctcggcgctgcgcgcggcgggcgtcgagcagatc
atcgtcgtcgaaccggccgaggtgcggaagaagaaggccgagccggccggggcggaccac
atcatcgacccgcgcgacggcgacgtcaccgagcaggtgctggagctgaccggcggccgt
ggcgccgacgtctccttcgaatgcgccggcatcgacgcggtcctgaagaccgctatccag
tccacccgggcgggcggcacgtgcgtgaacgtcgcgatctggggccacgaggcgagcgtc
gccatgaacgacctcgtcttccgcgaggtcaacctgctcggcagcctcgcctacgcgaac
gatcatcccgccacgatcgagatgatcgcctccggcaaggtcgacccctaccagttcatc
accggccggatcgggctcgacgacatcgtcaaggacggcttcgaggaactgatcaccaac
aaggaggagaacgtgaagatcctcgtccagccgtga

DBGET integrated database retrieval system