KEGG   Rhodococcus aetherivorans: AAT18_24600Help
Entry
AAT18_24600       CDS       T03876                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
rav  Rhodococcus aetherivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AKE91893
UniProt: A0A059MIF5
LinkDB All DBs
Position
complement(5465159..5466613)
Genome map
AA seq 484 aa AA seqDB search
MTTATPIQLKSYDKLFIGGSWVEPSSDAVIEVISPINGEVIATVPEAREADMDRAVAAAR
KAFDEGPWPRMTPAERAEILVRVGNEVKKRIPEMAEAFTLELGAPAAVSTLFHQNAVDMW
DDAATFHERFAFEEERTWKGGHGKIVREPIGVVAVVVPWNGPVATGSLKISPALAAGCTV
VLKPAPEGPVTMMMLAEALDAAGLPEGVISVVPAGREVGDYLVSHPDVDKISFTGSTAAG
RVVMSRAAERIKRVTLELGGKSAAIIADDIDLDTFLPGMVFGGIGHSGQVCAALTRIIVP
RERQEEVVEAIKAVMESVKVGDPRDEDTVLGPLAAERQQTRVLDYIEIGKKEGARLVTGG
GKPAHLDRGWYVEPTLFADVSNDMRIAQEEIFGPVLVVIPFDSIDEAVAIANDSDYGLSG
SVYARDEELAQSIARRVRTGQISVNGYAMCVVQPFGGYKQSGLGREGGIEGFDAFFETKL
IQLP
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgaccacagccactcccatccagctgaagagctacgacaagctgttcatcggcggatcg
tgggtcgagccgtccagcgacgcggtgatcgaggtgatctccccgatcaacggcgaggtc
atcgcgaccgtgcccgaggcgcgcgaggcggacatggaccgcgccgtcgcggcggcgcgc
aaggcgttcgacgaaggtccctggccgcggatgacgcccgccgagcgggcggagatcctc
gtgcgcgtcgggaacgaggtgaagaagcgcatccccgagatggccgaggccttcaccctc
gaactgggcgcccccgcagcggtttccactctgttccaccagaacgctgtcgacatgtgg
gacgacgcggccacgttccacgagcgcttcgcgttcgaggaggagcgcacctggaagggc
gggcacggcaagatcgtgcgtgagcccatcggtgtcgtcgcggtcgtggtcccgtggaac
ggtccggttgcgaccggctcgctgaagatctcgcccgcactcgccgcgggctgcacggtg
gtgctcaagccggccccggagggccccgtcacgatgatgatgctggccgaggcgctcgac
gccgccggtctgcccgaaggcgtcatcagcgtcgtgccggcaggacgggaggtgggtgac
tacctcgtcagccacccggacgtcgacaagatcagcttcaccggcagcacggcggccggc
cgcgtcgtcatgagccgggccgccgagcggatcaagcgggtcaccctcgagctgggcggc
aagtctgccgcgatcatcgccgacgacatcgacctggacaccttcctgcccggcatggtg
ttcggcggcatcggtcactcggggcaggtctgcgccgccctcacccgcatcatcgtcccg
cgcgagcgccaggaggaggtcgtcgaggcgatcaaggcggtgatggagagcgtgaaggtc
ggtgatccccgtgacgaggacactgtcctcggccccctggccgccgagcgtcagcagacg
cgggtgctcgactacatcgagatcggcaagaaggagggtgcccgtctggtgaccggtggc
ggcaagcccgcccacctcgaccgcgggtggtacgtcgaaccgaccctgttcgcggacgtc
tccaacgacatgcgcatcgcgcaggaggagatcttcgggcctgtgctggtggtcattccg
ttcgattcgatcgacgaggccgtcgccatcgccaacgactcggactacggcctctccggc
tccgtctacgcgagggacgaagagctggcccagagcatcgcgcgacgggtgcgcaccggc
cagatctccgtcaacggctacgcgatgtgcgtcgtgcagcccttcggcggctacaagcag
tccggtctcggccgcgagggcggcatcgagggcttcgacgcgttcttcgaaaccaagctg
atccagcttccctga

DBGET integrated database retrieval system