KEGG   Rousettus aegyptiacus (Egyptian rousette): 107497012
Entry
107497012         CDS       T06036                                 

Gene name
LAMA2
Definition
(RefSeq) laminin subunit alpha-2
  KO
K05637  laminin, alpha 1/2
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04151  PI3K-Akt signaling pathway
ray04510  Focal adhesion
ray04512  ECM-receptor interaction
ray05145  Toxoplasmosis
ray05146  Amoebiasis
ray05165  Human papillomavirus infection
ray05200  Pathways in cancer
ray05222  Small cell lung cancer
ray05410  Hypertrophic cardiomyopathy
ray05412  Arrhythmogenic right ventricular cardiomyopathy
ray05414  Dilated cardiomyopathy
ray05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    107497012 (LAMA2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    107497012 (LAMA2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107497012 (LAMA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107497012 (LAMA2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    107497012 (LAMA2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107497012 (LAMA2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107497012 (LAMA2)
   05414 Dilated cardiomyopathy
    107497012 (LAMA2)
   05416 Viral myocarditis
    107497012 (LAMA2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107497012 (LAMA2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107497012 (LAMA2)
   05145 Toxoplasmosis
    107497012 (LAMA2)
SSDB
Motif
Pfam: Laminin_G_1 Laminin_G_2 Laminin_EGF Laminin_I Laminin_N Laminin_B Laminin_II Laminin_G_3 DUF948 DUF2630
Other DBs
NCBI-GeneID: 107497012
NCBI-ProteinID: XP_015973829
LinkDB
Position
Unknown
AA seq 3145 aa
MLCNSIKLILQSFQARCPLAFTWKNSTVYQVAYFCVQVLSHGLFPAVLNLASNALITTNA
TCGEKGPEMYCKLVEHVPGQPVRNPQCRICNQNSSNPYQRHPITNAIDGKNTWWQSPSIK
NGIEYHYVTITLDLQQVFQIAYVIVKAANSPRPGNWILERSLDDVEYKPWQYHAVTDTEC
LALYNIYPRTGPPSYAKDDEVICTSFYSKIHPLENGEIHISLINGRPSADDPSPELLEFT
SARYIRLRFQRIRTLNADLMMFAHKDPREIDPIVTRRYYYSVKDISVGGMCICYGHARAC
PLDPVTNKSRCECEHNTCGDSCDQCCPGFHQKPWRAGTFLTKTECEACNCHGKAEECYYD
ENVARRNLSLNIHGKYIGGGVCINCTQNTAGINCETCADGFFRPKGVSPKYSRPCQPCYC
NSIGSLNKVCVKDEKHARRGLAPGSCHCKPGFSGVSCDRCARGYTGYPDCKPCNCSGEGS
MNEDPCLGPCNCKENVEGGDCSRCKPGFFNLQEDNHKGCDECFCSGVSNRCQSSYWTYGS
ILDMSGWYLTDISGRTRVAPQQDNLDSPQQISISSVEARRALPQGYYWSAPNSYLGNKLT
AAGGQLTFTVSYDLEEEEEEDAEGILQLMIILEGNGLRISTAQDEVYLQPSEEHINVLSL
KEELFTVHGTNIPVSRKEFMTVLVDLKRVLLQITYSLGVDAIFRLSSVGLESAVPYPTDG
SFATAVEVCQCPPGYTGSSCERKHQANAPSNLIPANNAKSCWPRHRRVNGTIFGGICEPC
QCFSHADSCDDITGECLNCRDHTGGSYCNKCLPGFYGDPTKGTSEDCQPCACPLNIASNN
FSPTCHLDRSLGLICDECPVGYTGPRCERCAEGYFGQPSVPGGSCQPCQCNDNLDFSIPG
SCDSLSGSCLICKPGTTGRYCELCADGYFGDAVDAKNCQPCRCNANGSLSEICHARTGQC
ECKPNVQGQRCDECKPETFGLQSARGCVPCNCNSFGSKSFDCEESGQCWCQPGVTGKKCD
HCAHGYFNFQEGGCTACDCSHLGNNCDPKTGQCICPPNTIGETCSKCVPNTWGHSIISGC
KACNCSAVGSLDFQCNINTGQCNCHPKFSGAKCTECNRGHWNYPHCNPCDCFLPGTDDTT
CDSETKKCFCMDRTGQCTCKVNVEGVHCDRCRPGKFGLDAKNPLGCSSCYCFGAATQCSE
AKGLIRTWVTLKPEQTILPLVDEALRHTTTKGIIFQDPEIVADMDLVREDLHLEPFYWKL
PEQFEGKKLMAYGGKLKYAIYFEAREETGFTTYNPQVIIRGGTPTHARIIIRHMAAPLIG
QLTRHEIEMTEREWKYYGDDPRVSRTVTREDFLDILYDIHYILIKATYGNVMRQSRISEI
SMEVAEKGRITAVTPPAHLIESCDCPPGYSGLSCETCMPGFYRLRSEPGGLTPGPTLGTC
VPCQCNGHSSICDPETSICQNCQHHTAGDFCEQCSLGYYGIVKGLPNDCQQCACPLISSS
NNFSPSCVMEGLDDYRCTACPRGYEGQYCERCSLGYTGSPSSPGGSCQECECDPYGSMPV
PCDPVTGLCTCRPGATGRKCDGCKHWHAREGMECVFCGDECTGLLLGDLARLEQMATSIN
LTGPLPAPYKMLYGLENMTQELKHLLSPQRAPERLIQLAEGDLNTLVTEMNELLTRATKV
IADGEQTGQDAERTNTRADSLGEFIKELAQDAEAVNEKAIKLNETLGIQDKALERNLQEL
QKEIDRMMGELRRKNLDTQKEVAEDELVAAEGLLKKVNKLFGESRGKTEEMEKDLREKLA
DYENKLDDAWDLLREATDKIREANRLSTVNQKNMTALEKKKEAIESGKRQTENTLKEGND
ILDEANRLADEINSVIDYVEDIQTKLPPMSEELKDKIDDLSQEIKDRKLAERVSQAESHA
AQLNDSSAVLDGILDEAKNISFNATAAFKAYSNIKDYIDEAEKIAKEAKGLAHEATTLAT
GPQGSLKEGAKGSLQKSFGILNEAKKLANDVKENDDNLNGLKTRLEIADVRNGDLLRALN
DTLGKLSAIPNETAAKLQAVKDKARQANDTAKDVLAQIKALHQNLDGLKKNYNQLADSVA
KTNAVVKDPSKNKIIADAGATVKNLEQEADRLTDKLKPIKELEDNLRKNISEIKELINQA
RKQANSIKVSVSSGGDCIRTYKPEIKKGSYNNIVVNVKTAVADNLLFYLGSAKFIDFLAI
EMRKGKVSFLWDVGSGVGRVEYPDLTIDDSNWYRIEASRTGRNGSISVRALDGPKASIVP
STYHSVSPPGYTILDVDANAMLFVGGLTGKLKKADAVRVITFTGCMGETYFDSKPIGLWN
FREIEGDCKGCTVSPQVEDSEGTIQFDGEGYALVSRPIRWYPNISTVMFKFRTFSSNALL
MYLATRDLKDFMSVELADGHIKVSYDLGSGMASVVSNQNHNDGKWKSFTLSRIQKQANIS
IIDIDTNQEENIATSSSGNNFGLDLKADDKIYFGGLPTLRNLSMKARPEVNLKKYSGCLK
DIEISRTPYNILSSPDYVGVIKGCSLENVYTVSFPKPGFVELPPVPIDVGTEINLSFSTR
NESGIILLGSGGTPAPPRRKRRQTAQAYYAIFLNKGRLEVHLSTGTRTMRKIVVKPEPSL
FHDGREHSVHVERTRGIFTVQVDEDRRHMQNLTVEQAIEVKKLFIGGAPPEFQPSPLRNI
PPFEGCVWNLVINSVPMDFAQPISFKNADIGRCTHQKPYEDEDGAIPAEIVIQPEPVPTP
AFPIPTPILAHGPCAAESEPAFLIGSKQFGLSKNSHIAIAFDDTKVKNRLTIEFDVRTEA
ESGLLFYMARINHADFATVQLKNGFPYFSYDLGSGDTNTMIPAKINDGQWHQIKIMRIKQ
EGILYVDGASNRTISPKKADILDVVGMLYVGGLPINYTTRRIGPVTYSIDGCIRNLQMAE
ASVDLEQPTSSFHVGTCFATAQKGTYFDGTGFAKAVGGFKVGLDLLIEFEFRTTRATGVL
LGISSQKMDGLGIEMIDEKIMFHVDNGAGRFTAVYSAGIPGRLCDGQWHKVTANKIKHRI
ELTVDGNQVEAQSPNPASTSADTNDPVFVGGFPDGLNQFGLTTNIPFRGCIRSLRLTKGT
GKPLEVHFAKALELRGVQPVSCPAK
NT seq 9438 nt   +upstreamnt  +downstreamnt
atgctttgtaatagcatcaaattgattttgcagagttttcaagccagatgtcccttggca
tttacatggaagaactctactgtgtaccaagttgcatatttttgtgtgcaagttctcagc
catggtttatttcctgctgtcttgaatcttgcttctaatgctctcatcaccacaaatgca
acatgtggagaaaaaggacctgaaatgtattgcaagttggtagagcatgtgcctgggcag
cccgtgaggaacccccaatgtcgaatttgcaatcaaaacagcagtaatccatatcagaga
catccgattacgaatgctattgatggaaagaacacttggtggcagagtcccagtattaag
aatggaattgaataccattatgtgaccattacactggatttacagcaggtgttccagatt
gcatatgtgattgtgaaagcagctaactctcctcgtccaggcaactggattttggaacgg
tcgctcgatgatgttgaatacaagccctggcagtatcatgctgtgacggacacagagtgc
ttagccctctacaatatttatccccgcactggaccaccatcatatgccaaagacgatgag
gtcatctgcacttcattttattccaagatacaccctttagaaaatggagagattcacatc
tctttgatcaatgggagaccaagtgctgatgacccatctcctgaactgctagaatttacc
tcagctcgctacattcgcctgagatttcagcggatccgcaccttgaatgctgatttgatg
atgtttgctcacaaagacccaagagaaattgaccccattgtcacacgaagatattactac
tcggtcaaggatatttcagttggagggatgtgcatctgctatggtcatgcgagggcttgt
ccacttgatccagtgacaaataaatcccgctgtgaatgtgagcataatacatgcggtgat
agctgtgatcagtgctgtccagggttccatcagaaaccgtggcgagctgggactttcctg
actaaaactgaatgcgaagcatgcaattgtcatgggaaagctgaagaatgctattatgat
gaaaatgttgctagaagaaatctgagtttaaatatacatgggaagtacatcggagggggt
gtgtgcatcaattgtacccaaaacaccgctggtataaactgtgaaacatgtgctgatggt
ttcttcagacccaaaggggtatctccaaagtattcaagaccatgccagccatgctattgt
aattcaattggttccttaaataaagtctgtgtcaaggatgaaaaacatgctcggcgaggt
ctagcacctggatcctgtcattgcaaacctggctttagcggggtgagctgtgaccgatgt
gccaggggttacactggctacccagactgtaaaccctgtaactgcagtggtgaaggaagc
atgaatgaggacccttgtttgggaccttgcaactgcaaggagaatgttgaaggaggagac
tgcagtcgctgcaaacctggcttcttcaatttgcaagaggataatcataaaggttgtgat
gaatgtttctgctccggggtttccaacaggtgtcagagttcctactggacctatggcagc
atactagacatgagtggctggtatctgactgacatctcaggccgcactcgagtggctccc
cagcaggacaacttagattcacctcagcagatcagcatcagtagtgtggaggcccgcaga
gccctaccccaggggtactactggagtgcaccaaattcatatctgggaaacaaactcaca
gcagctggaggacaattgacatttacggtatcatatgacctcgaagaagaagaagaagaa
gatgcagagggcatactccagcttatgattatcttagagggaaatggcttgagaatcagc
acagcccaagatgaggtgtatctgcaaccatctgaagaacacattaatgtattgtcactt
aaagaagaattatttactgtacatggcacaaatatcccagtcagtagaaaagagtttatg
actgtgcttgtggatttaaagagagtcctcctacaaatcacatacagccttggggtggat
gccatcttcaggctgagctctgtcggccttgaatctgctgtcccctaccctactgatgga
agctttgcaacagctgtggaagtttgtcaatgtccacccgggtatactggctcctcttgt
gaaaggaaacaccaagctaatgctccctctaatctcattcctgccaataacgctaagtca
tgttggcctaggcacagacgagttaacggcactatttttggtggcatctgtgaaccttgt
caatgctttagtcatgcggactcctgtgatgacatcaccggagaatgtctgaattgtagg
gatcatacaggtggctcatattgcaataaatgtcttcctggtttctatggagatcctact
aaaggaacctctgaagactgtcagccctgtgcctgtccacttaatatcgcatccaataac
tttagcccgacgtgccatttagaccgaagccttggattgatctgtgatgaatgccctgtc
gggtatacaggaccacgctgcgagaggtgtgcagaaggctattttggacaaccttctgta
cctggaggatcatgtcagccatgccaatgcaatgacaaccttgacttctccatccctggc
agctgtgacagcttgtctggctcctgtctgatttgtaagccaggtacaacaggccggtac
tgtgagctctgtgctgatggatattttggagacgcagttgatgcaaagaactgtcagcct
tgtcgttgtaatgccaatggctccttgtctgagatttgccatgccaggacaggacagtgt
gaatgtaaacccaatgtgcagggccaacggtgtgatgagtgcaagcctgaaacctttggt
ctacagtcagcaagaggatgtgttccctgcaactgcaattcctttgggtctaaatcattc
gactgtgaagagagtggtcagtgttggtgccagcctggagtaacaggaaagaagtgtgac
cactgtgcccatggctatttcaacttccaagaaggaggatgcacggcttgtgactgttcc
catctgggtaataattgtgatccaaagactggtcaatgcatttgccctcccaataccatt
ggagaaacatgttctaaatgtgtacctaatacctggggccacagcattatctctggttgt
aaggcttgtaactgcagcgcggtgggatccttggatttccaatgcaatataaacacaggc
caatgcaactgtcatccaaaattttctggtgcaaaatgtacagagtgcaatcgaggtcac
tggaactaccctcactgcaatccctgtgactgcttcctgcccgggactgatgacacgacc
tgtgattcagagactaaaaaatgcttctgtatggatcgcactgggcaatgcacttgtaag
gtgaatgtggaaggtgtccattgtgacaggtgccggcctggcaaattcggacttgatgcc
aagaacccacttggctgcagcagctgttattgcttcggcgctgctactcagtgctctgaa
gcaaaaggactgatccgtacgtgggtgactctgaagcctgagcagaccattctgccccta
gtggatgaggcactccggcacacgactaccaaaggcattattttccaagatccagagatt
gttgcagacatggatctggtaagagaagatctccatttagaacctttttattggaaactt
ccagaacaatttgaaggaaagaagttgatggcctatggtggcaaactcaagtatgccatc
tattttgaggctcgagaagagacaggtttcactacatataatcctcaagttatcattcga
ggtgggactccaactcatgctagaattatcatcaggcatatggctgcccctctaattggc
cagttgacaaggcatgaaattgaaatgacagagagagaatggaaatattatggtgatgat
cctcgagtcagtagaactgtgacgcgtgaagatttcttggatatactatatgatatccat
tatattcttatcaaagctacttatggaaatgtcatgagacaaagcaggatttctgaaatt
tcaatggaggtagcagaaaaaggacgcataacagcagtgactcctccggctcacttgatt
gaaagttgtgattgtcccccgggttattctggtttatcctgtgagacgtgcatgccggga
ttttatcgactgcgttctgagccaggtggcctcacccctgggccaaccctgggcacctgt
gttccatgtcagtgtaatggacacagcagcatttgtgaccctgagacctccatatgtcag
aattgtcaacatcacactgctggtgacttctgtgaacaatgtagtctcggatactatgga
attgtcaagggattgccaaatgactgtcagcaatgtgcttgccctctgatttcctccagc
aacaacttcagcccatcttgtgtcatggaaggactcgatgattaccgctgcacggcttgt
ccgcgtggatatgaaggccagtactgtgaacggtgttccctgggctacactggcagccca
agcagccccggaggctcctgccaagaatgtgagtgtgacccctatggctcaatgcctgtc
ccctgtgaccctgtcacagggctctgcacatgccgacctggagcaactgggcggaagtgt
gatggctgcaagcactggcatgcacgcgagggcatggagtgtgttttttgtggagatgaa
tgtacgggccttcttctcggtgacttggctcgcctggagcagatggccacgagcatcaac
ctcactggcccgctgcctgctccatataaaatgctgtatggtcttgagaatatgactcag
gaactaaagcacttgctctcacctcagagggccccagagagactcattcagttggcagaa
ggtgatttgaatacactcgtgacagaaatgaatgagcttctaaccagggctaccaaagtg
atagcagatggtgagcaaactggacaggatgctgagaggaccaacaccagagcagactcc
ttaggagaattcattaaggaacttgcccaggacgcagaagctgtaaatgaaaaagctata
aaactaaatgaaactctaggaattcaagacaaggccttggagagaaatttgcaagagctt
cagaaagagattgatcggatgatgggagaattgcggaggaaaaatctagatacacagaaa
gaagtggctgaagatgagttggtagctgcagaaggcctgctgaagaaagtgaataagctg
tttggagagtcccgggggaaaaccgaagaaatggagaaagatctccgggagaaattggca
gattacgaaaacaagctcgatgatgcttgggacctgttgagagaagccacagataaaatc
agagaagccaatcgtttatctacagtaaaccagaaaaacatgactgctttggagaaaaag
aaagaggctattgaaagtggcaaacggcaaactgagaacactttaaaagaaggcaacgac
atacttgatgaagccaaccgtcttgcagatgaaatcaactcagtcatagattatgttgaa
gacattcaaactaaattgcctcccatgtctgaagagttgaaagataaaatagatgacctc
tctcaagaaataaaagacaggaagcttgctgagagggtgtcccaagctgagagccacgca
gcccagttgaatgattcatctgctgtccttgatggaattcttgatgaggctaaaaacatc
tccttcaatgccactgcagccttcaaagcttacagcaatattaaggactatattgatgaa
gctgagaaaattgccaaagaagccaaaggccttgcacatgaagctacaacactggcaaca
ggtcctcagggttcattaaaggaaggtgccaaaggctctcttcagaaaagcttcggtatc
cttaatgaagccaagaagttagcaaatgatgtcaaagaaaatgatgacaatttgaatggc
ttgaaaaccagattagaaattgctgatgttagaaatggtgatctcctgagagctctgaat
gacactttgggaaagttatcagcaattccaaatgaaacagcagctaaactgcaagccgtt
aaggacaaagcaagacaagccaacgacaccgcaaaagatgtactggcacaaattaaagct
ctccaccagaaccttgatggcctgaagaaaaattacaatcaactagcagacagtgtagcc
aaaacaaatgctgtggttaaagatccttcaaaaaacaaaatcattgcagatgcaggtgcc
actgtcaaaaatttagaacaagaagctgatcgactgacagataaactcaaacccatcaag
gaacttgaggataacctgagaaaaaacatttctgaaataaaggaactcataaaccaagcc
cgaaaacaagccaattctatcaaagtatctgtgtcttctggaggtgactgcattcgaaca
tacaagccagaaattaagaaaggaagctacaataatattgttgtcaatgtaaagacagct
gttgctgacaacctccttttttatcttggaagcgccaaatttattgactttctggctata
gaaatgcgtaaaggcaaagtaagcttcctctgggatgttggatctggagttggacgagta
gagtacccagatttgactattgatgactcaaattggtaccgtattgaggcctcaagaact
gggagaaatggaagtatttctgtgagagccctggatggacccaaagccagcattgtgccc
agtacataccattcagtgtctcctccagggtatacgattctagatgtggatgcaaatgcc
atgctgtttgttggtggcttaactgggaaattgaagaaggctgatgctgtacgtgttatt
acattcaccggctgtatgggagaaacatattttgacagcaaacctatagggttgtggaat
ttccgagaaatagaaggtgactgcaaaggatgtactgtcagtcctcaggtggaagatagt
gaagggactattcagtttgacggagaaggctatgcattggtcagccgccccattcgctgg
taccccaacatctccacagtcatgttcaagttcaggacattttcttcaaatgccctgctg
atgtaccttgctacacgagacctgaaagatttcatgagtgtagagcttgcggatgggcac
ataaaagtcagctatgatctgggttcaggaatggcttctgttgtcagcaatcaaaaccat
aatgatgggaaatggaaatcattcaccctctcaagaattcaaaaacaagccaacatatca
ataatagatatagatactaaccaagaagagaacatagcaacttcatcatctggaaacaat
tttggtcttgacttgaaagcagatgacaaaatatattttggcggtctgccaacactgaga
aacttgagtatgaaagcaaggccagaagtaaatttgaagaaatattctggctgcctcaaa
gatattgaaatttcaagaactccgtataatatactgagcagtcctgattatgttggtgtt
atcaaagggtgttccctggagaacgtttacacggttagcttccccaagccaggttttgtg
gagctgccccctgtgccaattgatgtgggaacagaaatcaacctgtccttcagcacccgg
aatgaatctgggatcattctcttgggaagcggagggacaccagcaccacctaggagaaaa
cgaaggcaaactgcacaggcctattatgcaatattcctgaacaagggccgtctggaagtg
catctctccacaggcacacgaacaatgaggaagattgttgtcaaaccagagccaagtctg
tttcacgacgggagagaacattccgttcatgtagagagaactagaggcatctttactgtt
caagttgatgaagacagaaggcatatgcaaaacctgacagtagaacaggcgattgaagtt
aaaaagcttttcattggaggtgctccacccgaatttcaaccttctccactaagaaatatt
cctccttttgaaggctgtgtatggaacctagttattaactctgtccccatggactttgca
cagcctatatccttcaaaaatgcagacattggtcgctgcacccatcaaaaaccctatgag
gatgaagacggagctattccagctgaaatagttatccagccagagccagttcccacccca
gccttcccaatacccaccccaattctggcacatggtccttgtgctgcagaatcagaacct
gcttttttgatagggagcaagcagtttgggctctcgaaaaacagtcacattgcaattgca
tttgatgacaccaaagttaaaaaccgcctcacaattgaatttgacgtgcggactgaagct
gaatcgggcctgcttttctacatggctcggatcaatcacgccgattttgctacagttcag
ctgaaaaatggatttccctacttcagttacgacttgggaagcggtgacaccaacaccatg
atccccgccaaaatcaatgacggccagtggcatcagattaagattatgagaattaagcaa
gaaggaattctttatgtagatggtgcctccaacagaaccatcagtcccaagaaagctgac
atcctggatgttgtaggaatgttgtacgttggcggactgcctatcaactacaccacccga
agaattggtccagtgacctacagcattgatggctgcatcaggaatcttcagatggcagag
gcctctgttgatcttgaacagccaacctccagcttccatgttgggacatgttttgcaact
gcgcagaaaggaacatattttgatggaacaggttttgctaaagcagttggtggtttcaaa
gtgggattggaccttcttatagaatttgaattccgcacaactagagccactggagttctt
ctgggaatcagcagccaaaaaatggatggactcggtattgaaatgattgatgaaaagatt
atgtttcatgtggacaatggtgctggccgattcactgctgtctacagtgccgggatccca
gggcgtctgtgcgatggacagtggcataaagtcacggccaataagatcaaacaccgtatt
gagctgacggtggatgggaaccaggtggaagcccagagcccaaacccagcatcaacatcg
gctgacacaaatgaccctgtgtttgttggaggtttcccagatggcctcaaccagtttggc
ctgacaaccaacattccgttcagaggttgcattcggtctctgaggctcaccaaaggcacg
ggcaaaccgctggaagttcattttgccaaagccctggaactcaggggagttcaacctgta
tcatgcccagccaaataa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107498184
Entry
107498184         CDS       T06036                                 

Gene name
LAMA1
Definition
(RefSeq) LOW QUALITY PROTEIN: laminin subunit alpha-1
  KO
K05637  laminin, alpha 1/2
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04151  PI3K-Akt signaling pathway
ray04510  Focal adhesion
ray04512  ECM-receptor interaction
ray05145  Toxoplasmosis
ray05146  Amoebiasis
ray05165  Human papillomavirus infection
ray05200  Pathways in cancer
ray05222  Small cell lung cancer
ray05410  Hypertrophic cardiomyopathy
ray05412  Arrhythmogenic right ventricular cardiomyopathy
ray05414  Dilated cardiomyopathy
ray05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    107498184 (LAMA1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    107498184 (LAMA1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107498184 (LAMA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107498184 (LAMA1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    107498184 (LAMA1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107498184 (LAMA1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107498184 (LAMA1)
   05414 Dilated cardiomyopathy
    107498184 (LAMA1)
   05416 Viral myocarditis
    107498184 (LAMA1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107498184 (LAMA1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107498184 (LAMA1)
   05145 Toxoplasmosis
    107498184 (LAMA1)
SSDB
Motif
Pfam: Laminin_G_1 Laminin_EGF Laminin_G_2 Laminin_B Laminin_I Laminin_N Laminin_II Laminin_G_3 Hepar_II_III DUF1080
Other DBs
NCBI-GeneID: 107498184
NCBI-ProteinID: XP_015976454
LinkDB
Position
Unknown
AA seq 3121 aa
MLLFFSQSFKYCFLNSLDLLLKDENHWRKKDGRKAKINTELKRTLKTGSLCPKWLSQFGE
FRLSGLFPAILNLASNAHISTNATCGEKGPEMFCKLVEHVPGRPVRNAQCRICDGTSANP
KERHPISNAIDGTNNWWQSPSIQNGREYHWVTITLDLRQVFRVAYVIVKAANAPRPGNWI
LERSLDGTKFRPWQYYAVSDTECLTRYNITPRRGPPTYRADDEVICTSYYSRLVPLEHGE
IHTSLINGRPSADDLSPKLLAFTSARYIRLRLQRIRTLNADLMTLSHRDPKDLDPIVTRR
YYYSIKDISVGGMCICYGHASSCPWDETTKKLQCQCEHNTCGESCSRCCPGYHQQPWRPG
TISSGNMCEKCNCHNKAKDCYYDESVANQKRSLNTAGQFKGGGVCINCLQNTMGINCETC
IDGYYRPHKVSPYEDDPCHPCDCNPLGSFSSVCIKDDLHSDLHKGKWPGQCPCKEGYAGR
KCDRCQFGYKGFPACVPCDCNPAGSLNEDPCSEPCLCKENVEGKNCDRCKPGFYNLKERN
PQGCSECFCFGVSDVCDSLSWSISQVKDMSGWLVTDLISPNKIPSQQDVLGRHHQISTNN
TMVMQRLTSEYYWLAPEAYLGNKLTAFGGFLKYTVSYDIPMETVDSDLVSHADVIIKGNG
LTLSTQAEGQTLPPHEEYYNVVRFVPENFRDFNNKREIDRDQLLTVLANVTHLLIRANYN
SAKMALYRLDSVSLDTASPNVIDLALATEVEHCECPQGYAGISCESCLSGYYRVDGILFG
GICQPCECHGHTTECDIHGVCFACEHNTTGDHCEQCLPGFYGLPSQGIPGDCQPCACPLS
SASNNFSPTCHLDDGDEVVCDQCTLGYSGTWCERCADGYYGNPTVPGESCVLCNCSGNVD
PSEAGHCDSVTGECLRCIGNTDGAHCERCADGFYGDAVAAKNCRACECHGKGSLSGVCHL
ETGLCDCKPHVTGQQCDQCLHGYYGLDTGLGCLPCNCSTTGSMSDDCSEEGQCHCVPGVA
GKRCDRCARGFYAFQDGGCTPCDCAHTQNTCDAASGVCICPPHTRGVACGECEDDHWGYD
PELGCQACNCSSEGSASHQCDVLTGHCQCKPAFGGPSCDQCSLGFRGFPDCVSCNCDLRG
TLVDTCDEKQGLCSCAEETGTCSCKENVLGLQCNECRAGTYALHADNPLGCTPCFCFGLS
QLCLEAEGYVRMPITLSSDQPLLRVVSQSNLRGTTEGVYYQAPDVLLDAVTVRQHVRAEP
FYWRLPGQFQGDQLMAYGGKLKYNVAFYSSNGMGTFNLEPQVLIKGGRTRKQVIYMDAPA
PENGVRQEQEVGMKENYWKYFNSVSEKPVTRSDFMSVLSNIEYILIKASYGQGLQQSRIA
NISMEVGREAEELHPGGAAASLVERCLCPPGTAGLSCQDCASGYYRGKLPDGGGRGPRLL
LAPCVPCNCNNHSNICDPETGKCLDCSDHTTGDHCDVCAPGYYGKVTGSASDCFLCTCPH
SRPASFSPTCVLEGDHDFRCDACVLGYEGQYCERCSSGYHGNPRVPGGTCQRCDCSPRGS
VHGDCDRGSGQCVCRPGAAGLRCEECEPRHILVESNCISCDGECVGVLLNDLDNIGNTIL
SVNLTGIVPVPYGILSNLENTTKYLQESLLKENTQKELAKSQLEDVADQIDDLQRELTRV
LTSSQHVTRATERILSKSQDLMTFTEKLKISIQEIIEKATTLNQTLDEDFHLPSSTLQNM
QKNITSLLEAIQERNFMQLHENATLELRAAEDLLSQIQKNYQKPQEELKKMKEAASSLLS
KHNSELQAAEDLMREAESKTKESNRLLLIVNANLREFTGKKLRVQEKQNLTSTLIAKGRG
LLDTATARAKTTQNALAQLERHRDELLLWSAKIRHHVDDLVMQMSKRRALDLVYRAEDHA
AELLRLAGALDSGLENVRHVSLNATSATHIHSNIQSLIEKSDKLAKDALRTVTEVDMSSD
SLGSDGKAAVQRSSKLLKEGNSLSRKHQGFTLELKELKSTTHTFQENADKITRQTNESLL
MLRAIPEGARDKGTKIKELAITANQSAASTLKNVVGLSQKLLNTSMELSRVNATLRETNK
LLQDSSTITILAGRKVKDVETQANLLFDRLKPLKILEENLSRNLSEIKLLINQARKQAAS
IKVAVSADRDCIRAYQPRISSTNYNTLTLDVKTSEPDNLLFYLGSSTSSDFLAVEMRRGK
VVLLWDVGSGSARLEFPDFPIDDNKWHSIYVTRFGNIGSLSVKEMSTTQKPPQKTSKSPG
TANVLDINNSTLMFVGGLGGQIKKSPAVKVTHFKGCMGEAFLNGQSIGLWNYIEREGECH
GCFGSSQNEDSSFHFDGSGYSVVEKTLRATVTHIIILFSSFSPNGLLLYLASNGTKDFLS
IELVHGRVKVTVDLGSGPLALLTDQRYXNGTWYKIVFQRNRKQGLLAVIDAYNTSYKETK
QGETPGASSDLNRLDKDPIYVGGLPRSRVVRKGVTSKSYVGCIKNLEISRSTFDLLRNSY
GVRKGCILEPIRSVSFLRGGYIELPPRSLSPESEFLATFATTDSSGIILAALSKHGEKEG
RQQAHGPFFSIMLIEGHIEVHVDSGDGTGLRRALLHAPTGTFADGQGHSISLIRSGRIIT
IQLDEKTPVEMQLGPAVESMTMNVSNLYIGGIPEDAGSSMLRMRRSFHGCIRNLIFNMEL
LDFTSAVGSEQVDLDTCLLSERSKLALHGEDGELLPEPQPLPSPQLCAVDAAPEYVPSAH
QFGLTQSSHFVLLFNQLAIRRRLSVQLSIRTFASSGLIYYMAHQNQVDYAMLQLHEGRLH
FTFDLGKGRTKVSHPALLSDGTWHTVKTEYFKRKGFMVVDGQESSMVTTVGDGTTLDVEG
KLYLGGLPSDYRARNIGNITHSIPACIGEVTVNGKQLGTDNPVSAFAVARCYAEAQEGTF
FEGSGYAALVKEGYKVRSDVNITLEFRTSSENGVLLGISSAKVDAIGLEMVNGKLLFHVN
NGAGRITATYEPKATNTLCDGKWHTLQANKSKHRVVLIVDGNAVHAESPHTQSTSVDTND
PIYIGGYPADVKQNCLSSQRSFRGCLRKLTLRKGLQVQSYDFSRAFDLHGVVPHSCPGAE
P
NT seq 9366 nt   +upstreamnt  +downstreamnt
atgctgttatttttctcacagtcattcaaatattgttttctgaatagtttggacctactg
cttaaagatgaaaatcactggcgaaaaaaggacggtagaaaggcaaagattaacactgaa
ttgaagagaactttgaaaactggatctttgtgtcctaagtggctgagccaatttggtgaa
tttcgactttcaggcctatttcctgccattctcaatcttgccagcaatgctcacatcagc
accaatgcgacgtgtggtgagaaggggcctgagatgttctgcaaacttgtggagcacgtg
cccggacgacctgtgcggaacgcacagtgccggatctgtgatggcaccagcgccaacccc
aaagaacgccatccaatatcaaatgcgatcgatggcaccaataactggtggcaaagtccc
agtattcagaacggaagggaatatcactgggtcacaataactctggacttaagacaggtt
tttcgagtcgcctatgtcatcgtcaaagctgctaatgcccctcgccctggaaactggatt
ttggaacgttctctggatggcaccaagttcagaccctggcagtactatgcagttagcgac
acagagtgtttgactcgttacaatataacccctagacgggggccacccacttatagggct
gatgatgaagtgatctgcacctcgtattactctaggctggtaccacttgagcatggagag
attcacacatcactaatcaatggcagaccaagcgctgatgatctttctcccaagttgctg
gcatttacttctgcacgatatatccgccttcgtttacagcgcattagaaccctcaatgcc
gaccttatgactctcagccatcgtgaccccaaagacctcgaccctattgttacaagacga
tattactattcaataaaagacatttctgttggaggaatgtgtatttgttatggtcatgct
agtagctgcccatgggatgaaaccacaaagaaactacagtgtcagtgtgaacataacacc
tgcggagagagctgcagtaggtgttgtcctggataccatcagcagccctggaggcctggg
accatttcttctggtaacatgtgcgaaaaatgtaattgtcacaataaagccaaagactgt
tactatgatgaaagtgttgcaaatcagaaaaggagtttgaatactgctggacagttcaaa
ggaggaggagtttgcataaattgcctgcagaacaccatgggaatcaattgtgaaacctgt
atcgatggatattatagaccacacaaagtgtctccttatgaggacgacccttgccatccc
tgtgactgtaaccctttggggtccttcagttctgtctgtattaaggatgatcttcattct
gacttacacaaaggaaagtggccaggtcaatgtccatgcaaggaaggttatgcaggaaga
aaatgtgatcgctgccagtttggctataagggtttcccagcctgtgtaccctgtgactgt
aacccagcaggaagcttgaatgaggacccatgctcggagccttgtctctgtaaggaaaat
gttgaggggaaaaactgtgatcgttgcaagccaggattttataatttgaaggaaagaaac
ccccagggctgctctgagtgcttctgctttggcgtctctgatgtctgcgacagcctttct
tggtccatcagtcaggtgaaagatatgtctgggtggctggtcactgacctgatcagtcca
aataagatcccatctcaacaggacgtgctgggaagacatcatcaaatcagcaccaacaac
acaatggtcatgcagaggctgacttctgagtattattggttggccccagaggcctacctt
ggaaataagctgactgcatttggtgggttcctgaagtacactgtgtcttacgatattcca
atggaaacagtggacagtgacctcgtgtctcatgccgacgttatcattaagggaaatgga
ctcactttgagcacccaggctgaaggccagacattaccaccccatgaagagtactataat
gtggttagatttgtgcctgagaacttccgagattttaataacaaaagggagatagatcgt
gaccaactgctgactgtccttgccaatgtgacacatctcttgatcagagccaactacaat
tctgcaaaaatggctctttataggttggattctgtctctctggacacagccagtcctaac
gttatagacctagcactggccactgaggtggagcactgcgaatgtccccaaggctatgca
gggatctcctgtgagtcctgcctctctggctattaccgtgtggacggcatactctttgga
ggaatttgtcaaccctgtgaatgccacggccatacaactgagtgcgatattcatggtgtc
tgctttgcgtgcgaacacaacaccactggggaccactgtgaacagtgtctgcctggcttc
tatgggctgccgtcccaagggattcctggggattgccagccttgtgcctgccccctctct
tcagcctccaacaatttcagccccacctgccacctagatgatggtgatgaagtggtctgt
gaccagtgtaccctgggatactcaggaacttggtgtgagagatgtgcagacggttactat
ggaaacccaacagtgcctggagaatcctgtgttctgtgtaactgcagcggcaatgtcgac
ccctcagaggccggtcactgtgactctgtcaccggagaatgcctgaggtgtattgggaac
acagatggggcccactgtgagagatgtgctgacgggttctatggggacgctgtggctgct
aaaaattgccgcgcctgtgaatgccatggaaagggctccctttctggtgtctgccatctt
gagactggactctgtgactgcaaaccacatgtgactggacagcagtgtgaccagtgcttg
catggctattatgggttggacacaggccttggctgcctgccctgtaactgcagcacaacg
ggctccatgtcagatgactgctcagaggaaggccagtgtcactgtgtaccaggtgtagct
gggaaaaggtgcgacaggtgtgcacgtggcttctatgcattccaggatggtggctgtaca
ccctgtgactgtgctcacactcagaatacttgtgacgcagcatcgggggtgtgtatatgc
cctcctcatactcgaggcgtagcatgtggagaatgtgaggacgaccactggggctatgac
ccggagctcggatgccaggcctgcaattgcagcagtgaagggtcagccagtcatcaatgt
gatgtgctcactggccattgccaatgtaagcctgcgtttggtggaccgagttgtgaccag
tgctccctgggtttcagaggctttccagactgtgtgtcctgcaactgtgacctgagagga
acattagtggacacttgtgatgagaaacagggtctttgcagctgtgcagaggaaactggt
acctgctcttgcaaggaaaatgtccttggccttcaatgcaacgagtgtcgagctggcacc
tacgctctccatgccgacaaccctctggggtgcactccgtgcttctgctttgggctgtca
caactctgcctggaagcggagggttatgtgaggatgccgataacactgagctcagatcag
cctcttctgcgtgtggtttctcagagtaacctcaggggcacgactgagggggtatattac
caggctcctgatgtcctcctggatgctgtgaccgtcagacagcatgttcgtgcagagcca
ttttactggcggctgccagggcagttccagggagaccagctcatggcctatggcggcaaa
ctgaagtacaatgtggccttctattcctccaacggcatgggcaccttcaaccttgagcct
caagtgctcatcaaaggaggccgaaccagaaagcaagtcatttacatggatgcgcctgca
ccagagaacggagtgagacaagagcaagaagtaggaatgaaagagaattattggaaatat
tttaattctgtttctgaaaaacctgttacgcgctcagattttatgtctgttctgagcaac
attgagtacatcctcatcaaagcgtcttatggtcaaggattgcaacaaagcaggatcgca
aacatttcgatggaggtcggcagagaggctgaagagctgcacccgggcggggcggcggcc
tccctggtagagcggtgtctttgtcctcctggcacagctgggctctcctgccaggattgc
gcatctggatactacagagggaagcttccggacggtggtggcaggggacctcgccttcta
cttgctccttgtgtgccctgcaattgcaacaaccacagtaacatctgtgaccctgaaacg
ggaaaatgtctggactgcagtgatcacaccactggtgaccattgtgatgtgtgtgccccc
gggtactatgggaaggtgactggctcagccagtgactgctttctgtgcacctgtcctcac
agccgccctgccagttttagtcccacgtgtgtcttggaaggtgatcacgatttccgctgc
gatgcctgtgttctgggctatgaagggcaatattgcgagaggtgctcctcaggctatcac
gggaaccctcgagtgccaggtggcacttgccagaggtgtgactgcagtccacgaggctct
gttcatggtgactgtgaccgcgggtctggacagtgtgtctgcagaccaggggccgcaggg
ctccgatgcgaggaatgtgaacccaggcacattctggtggaaagcaattgtatttcttgt
gatggtgaatgtgtaggtgtactgctgaatgacttagacaatatcggcaataccattctt
tctgtgaacctcacgggcattgtccccgtcccatatggaattttgtcgaacctggaaaat
acaactaagtacctccaggaatctttattaaaagaaaatacacaaaaggaactggcaaaa
agtcagcttgaagatgttgcggatcaaatagacgatctacaaagggagctcactagagtg
ttaacaagtagccagcatgtgaccagggcaactgaaagaatcctcagcaagagtcaagac
ctcatgacatttactgagaagctgaagataagcattcaagaaattattgaaaaggcaaca
actctaaatcagaccttggatgaagatttccacctacccagttctactcttcagaatatg
caaaagaatattacatctttgctagaagccatacaggaaaggaatttcatgcaattgcac
gaaaatgccacccttgaactcagggctgctgaagatttattgtctcaaattcagaaaaat
taccagaagccacaggaagagttgaagaaaatgaaagaagcagcaagcagcctcctttcc
aaacacaacagcgaactgcaggcagcagaagacctcatgagggaggcagagtcaaagacc
aaggaaagcaaccgcctgctgctcattgtcaatgccaacctgcgagagttcactggtaaa
aaactgcgtgttcaagaaaaacaaaacttgacctcaacactaatcgccaaaggaagagga
ttgctagatactgccactgcacgtgcaaagactacgcaaaatgctctagcacagttagag
cgtcaccgggatgagctacttttatggagtgccaagatcaggcaccacgtggatgatctg
gtcatgcagatgtccaaaagaagagcacttgaccttgtctacagagctgaggatcatgca
gcagagctcctgagactagcaggtgctttggacagtggccttgaaaatgttagacatgtg
tccctgaatgcaaccagtgcaacccacatccattccaacattcagagcctgattgaaaaa
tcggataaattggcaaaagatgctctcaggactgtgactgaggtcgatatgtcctcagat
tccctcgggtctgatgggaaagcagctgtccaacgcagttccaaacttctaaaagaaggc
aacagcctgagcagaaagcatcaaggtttcacattggaactgaaagaattgaaaagtaca
acacacacctttcaagagaatgctgataaaattactaggcagaccaatgaatcactcttg
atgcttagagcaattcctgaaggtgccagagacaaaggaaccaaaatcaaagagctggcc
ataactgccaatcagagcgctgcaagcactctaaagaatgttgtgggactgagtcaaaag
ctgttgaacacatcaatggaactgtccagggtcaatgccacattacgagaaacaaacaaa
cttctacaggactcctcaacaatcactatattagctggaagaaaagttaaagatgtggaa
acacaagccaaccttttatttgatcggttgaagcctttgaagatattagaagagaaccta
agcagaaacctgtcagaaattaaactgctgatcaaccaggcccggaaacaagcagcttct
attaaagttgctgtgtctgctgacagagattgtatccgggcctaccagcctcggatttct
tctactaactataacaccttaacactggacgttaagacaagtgaacctgataaccttctc
ttttaccttgggagcagcaccagctctgatttcctggcagtggagatgcggcgagggaaa
gtggtcttgctctgggatgtgggctccgggtcggcacggttggaatttccagactttcca
attgatgacaacaagtggcacagtatctacgtgaccagatttggaaacattggttcattg
agtgtaaaggaaatgagtacaactcaaaagccaccacaaaaaacaagtaaatccccagga
acagctaatgtgctggatataaacaactctacactaatgtttgttggagggcttggagga
cagatcaagaagtctcctgctgtgaaggtcactcatttcaaaggctgcatgggggaggcc
ttcttgaatggacagtcgattggtctatggaactatatagaaagggaaggagagtgccat
ggctgcttcggaagctcccagaatgaagactcttccttccattttgatgggagtggatac
tctgttgtggagaagacactccgggctaccgtgacacacataattatcctttttagcagc
ttttcacctaatgggcttcttctctatcttgcttcaaatggcactaaagactttttatcc
atcgagctggttcatggcagagttaaagttacagttgacctgggctcagggcctctcgct
cttcttacagaccaacgctatnaaaatggaacctggtacaaaattgttttccagcgaaac
cggaagcaaggactcctagcagttattgatgcatataacactagttataaggaaaccaaa
caaggcgaaaccccaggagcatcttctgacctcaatcgtcttgataaggatccaatttat
gtgggtggattacctaggtcaagagttgtaaggaaaggtgtcaccagcaaaagctatgtg
ggctgtatcaaaaacctggaaatatccagatcaacctttgatttactcagaaattcctat
ggagtgagaaaaggctgtatactggagcctatccgaagtgtcagcttcttgagaggtggc
tacattgaattgccacccaggtctttgtcaccagaatcagaatttttggcaacatttgcc
accacggacagtagtggcatcatcctggctgccctgagcaagcatggggagaaggaaggt
cgtcagcaggcccatgggccgttcttttccatcatgctgattgaaggccacattgaagtg
catgttgactctggggatggaacaggcctgagaagagctctcctgcatgctcccacgggc
acgtttgccgatggacaagggcattctatctccttgataaggagcgggagaattatcacc
atccaactggatgagaaaactcctgtagaaatgcagttgggcccagcagtggaaagcatg
actatgaatgtgtctaacctgtacatagggggcattccagaggatgcagggtcatccatg
ctcaggatgaggcgatcattccacggctgtatcagaaacctcatctttaacatggaactt
ttggatttcactagtgcagttggctctgaacaagtggacttggacacctgcttgctttca
gaaaggtctaagctggctcttcatggagaagacggcgagctcctgccagagccccagcct
ttaccaagtccacagctgtgtgccgtggatgcagccccagagtatgtccccagcgctcac
cagtttggcctcacgcaaagcagccattttgtgctgcttttcaatcagttggctatcaga
aggaggctctcagttcagcttagtatccgaacatttgcctccagtggtctgatttactac
atggctcaccagaaccaagtggattatgccatgctccagctgcatgagggccgcctccac
ttcacgtttgatctcgggaagggcagaacaaaggtctctcatcctgcgctgctcagcgat
ggcacgtggcacacggtcaagacagagtactttaaaagaaagggcttcatggtggtcgat
ggccaagaatcctccatggtgaccacagtgggggatggcaccacactggacgtggaagga
aagctgtacctaggaggtcttccctctgattacagggccaggaacattggaaatatcacc
cacagcattcctgcttgcattggggaagtgacagtgaatggcaaacagctgggcacggac
aatccagtgtctgcgtttgcagtagccaggtgctatgcagaggcccaggaaggaactttc
tttgaaggaagtggatatgcagctcttgtcaaagaaggctacaaagtccgatcagatgta
aacatcacactagagtttcgtacttcctcagagaatggtgtcctcctggggatcagcagc
gccaaagtggatgccattgggttagaaatggtgaatggcaagctcttgtttcatgttaac
aatggtgctggtaggataacagccacatatgagcccaaagctaccaatactctctgtgat
ggaaagtggcacacactacaagctaacaaaagcaaacaccgtgtggttctgattgtcgat
gggaatgctgttcatgctgaaagtccacacacccagtccacctcagtggacaccaatgat
cccatctacattggtggctatcctgctgatgtaaagcaaaactgcctgagcagccagagg
tccttccgggggtgtctgagaaagctcactctgagaaagggcctgcaggtgcagtcctac
gacttcagcagagcttttgacctacacggagttgtccctcactcctgtcctggggccgag
ccctga

DBGET integrated database retrieval system