KEGG   Rousettus aegyptiacus (Egyptian rousette): 107497018
Entry
107497018         CDS       T06036                                 

Definition
(RefSeq) interleukin-3-like
  KO
K04736  interleukin 3
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04060  Cytokine-cytokine receptor interaction
ray04151  PI3K-Akt signaling pathway
ray04210  Apoptosis
ray04630  JAK-STAT signaling pathway
ray04640  Hematopoietic cell lineage
ray04664  Fc epsilon RI signaling pathway
ray05200  Pathways in cancer
ray05202  Transcriptional misregulation in cancer
ray05221  Acute myeloid leukemia
ray05310  Asthma
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107497018
   04151 PI3K-Akt signaling pathway
    107497018
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107497018
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107497018
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107497018
   04664 Fc epsilon RI signaling pathway
    107497018
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107497018
   05202 Transcriptional misregulation in cancer
    107497018
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    107497018
  09163 Immune disease
   05310 Asthma
    107497018
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107497018
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107497018
Cytokines and growth factors [BR:ray04052]
 Cytokines
  Interleukins
   107497018
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Haparin
  Cytokines
   107497018
SSDB
Motif
Pfam: IL3
Other DBs
NCBI-GeneID: 107497018
NCBI-ProteinID: XP_015973834
LinkDB
Position
Unknown
AA seq 139 aa
MHPTNPKMSSLPILRLLLLLLTAHAPQAQGRPLMTSLTEEDVNMMIKEIKSILPKPPLPP
QEPLDVNEIFILTNEAFLRQNLDTFLEATTNLPPDNGMKIKKILEKLKEIISSAPMTTEE
PISIEKGPSPVLAADRYRQ
NT seq 420 nt   +upstreamnt  +downstreamnt
atgcatcctaccaacccaaagatgagcagcctccccatcctgcgccttctcctgctcctg
ctcacagcccatgcccctcaagcacaggggcggcccttgatgacaagcttgactgaggaa
gacgtcaacatgatgataaaggaaattaagagcatcctgcccaagccgcctttgcctcca
caagaaccgttggacgtaaacgagatattcatcctaacgaatgaggcctttctgaggcaa
aacctggatacattcctggaagctaccacgaatttgccacccgataatggaatgaaaatt
aagaaaattcttgagaaactaaaagagataatctcgtccgcccccatgaccacggaagag
ccaatctctatagagaaaggcccaagccctgtgttggcggctgatcgctacaggcagtga

DBGET integrated database retrieval system