KEGG   Rousettus aegyptiacus (Egyptian rousette): 107497063
Entry
107497063         CDS       T06036                                 

Gene name
IL4
Definition
(RefSeq) interleukin-4
  KO
K05430  interleukin 4
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04060  Cytokine-cytokine receptor interaction
ray04151  PI3K-Akt signaling pathway
ray04630  JAK-STAT signaling pathway
ray04640  Hematopoietic cell lineage
ray04657  IL-17 signaling pathway
ray04658  Th1 and Th2 cell differentiation
ray04659  Th17 cell differentiation
ray04660  T cell receptor signaling pathway
ray04664  Fc epsilon RI signaling pathway
ray04672  Intestinal immune network for IgA production
ray05140  Leishmaniasis
ray05200  Pathways in cancer
ray05310  Asthma
ray05320  Autoimmune thyroid disease
ray05321  Inflammatory bowel disease
ray05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107497063 (IL4)
   04151 PI3K-Akt signaling pathway
    107497063 (IL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107497063 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107497063 (IL4)
   04660 T cell receptor signaling pathway
    107497063 (IL4)
   04658 Th1 and Th2 cell differentiation
    107497063 (IL4)
   04659 Th17 cell differentiation
    107497063 (IL4)
   04657 IL-17 signaling pathway
    107497063 (IL4)
   04664 Fc epsilon RI signaling pathway
    107497063 (IL4)
   04672 Intestinal immune network for IgA production
    107497063 (IL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107497063 (IL4)
  09163 Immune disease
   05310 Asthma
    107497063 (IL4)
   05320 Autoimmune thyroid disease
    107497063 (IL4)
   05321 Inflammatory bowel disease
    107497063 (IL4)
   05330 Allograft rejection
    107497063 (IL4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    107497063 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107497063 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107497063 (IL4)
Cytokines and growth factors [BR:ray04052]
 Cytokines
  Interleukins
   107497063 (IL4)
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Haparin
  Cytokines
   107497063 (IL4)
SSDB
Motif
Pfam: IL4 Ribosomal_S19e
Other DBs
NCBI-GeneID: 107497063
NCBI-ProteinID: XP_015973966
LinkDB
Position
Unknown
AA seq 134 aa
MGLTSQLIPALVCLLACTSNFTHGRRYIITLQEIIKTLNILTTRKDLCMELMVADVFAAP
KSTAEEESFCKVAAVLREVYTQHKCVNKKHLGKLDRNLSSLASKDCHVKEAKKNTLKNVL
ETLKMIMQEKYSKS
NT seq 405 nt   +upstreamnt  +downstreamnt
atgggtctcacctcccagctgattccagctctggtctgcttactagcatgtaccagcaac
ttcacccacggacgcaggtacatcatcaccttacaagagatcatcaaaacactgaacatc
ctcacgacgagaaaggacttgtgcatggagctgatggtggcggacgtcttcgctgcccca
aagagcacagcggaggaggagagcttctgcaaggttgcagcggtgcttcgggaggtctac
acacaacacaagtgcgtgaacaaaaaacacctgggcaagcttgacaggaacctgagcagc
ctggccagcaaggactgtcatgtgaaggaagccaagaaaaatacattgaaaaatgtcttg
gaaacgctaaagatgatcatgcaagagaaatactcaaagagttga

DBGET integrated database retrieval system