KEGG   Rousettus aegyptiacus (Egyptian rousette): 107497081
Entry
107497081         CDS       T06036                                 

Gene name
PLCB3
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3 isoform X1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00562  Inositol phosphate metabolism
ray01100  Metabolic pathways
ray04015  Rap1 signaling pathway
ray04020  Calcium signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04062  Chemokine signaling pathway
ray04070  Phosphatidylinositol signaling system
ray04071  Sphingolipid signaling pathway
ray04072  Phospholipase D signaling pathway
ray04261  Adrenergic signaling in cardiomyocytes
ray04270  Vascular smooth muscle contraction
ray04310  Wnt signaling pathway
ray04371  Apelin signaling pathway
ray04540  Gap junction
ray04611  Platelet activation
ray04613  Neutrophil extracellular trap formation
ray04621  NOD-like receptor signaling pathway
ray04713  Circadian entrainment
ray04720  Long-term potentiation
ray04723  Retrograde endocannabinoid signaling
ray04724  Glutamatergic synapse
ray04725  Cholinergic synapse
ray04726  Serotonergic synapse
ray04728  Dopaminergic synapse
ray04730  Long-term depression
ray04742  Taste transduction
ray04750  Inflammatory mediator regulation of TRP channels
ray04911  Insulin secretion
ray04912  GnRH signaling pathway
ray04915  Estrogen signaling pathway
ray04916  Melanogenesis
ray04918  Thyroid hormone synthesis
ray04919  Thyroid hormone signaling pathway
ray04921  Oxytocin signaling pathway
ray04922  Glucagon signaling pathway
ray04924  Renin secretion
ray04925  Aldosterone synthesis and secretion
ray04926  Relaxin signaling pathway
ray04927  Cortisol synthesis and secretion
ray04928  Parathyroid hormone synthesis, secretion and action
ray04929  GnRH secretion
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray04934  Cushing syndrome
ray04935  Growth hormone synthesis, secretion and action
ray04961  Endocrine and other factor-regulated calcium reabsorption
ray04970  Salivary secretion
ray04971  Gastric acid secretion
ray04972  Pancreatic secretion
ray04973  Carbohydrate digestion and absorption
ray05010  Alzheimer disease
ray05016  Huntington disease
ray05017  Spinocerebellar ataxia
ray05022  Pathways of neurodegeneration - multiple diseases
ray05142  Chagas disease
ray05143  African trypanosomiasis
ray05146  Amoebiasis
ray05163  Human cytomegalovirus infection
ray05200  Pathways in cancer
Module
ray_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107497081 (PLCB3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107497081 (PLCB3)
   04310 Wnt signaling pathway
    107497081 (PLCB3)
   04371 Apelin signaling pathway
    107497081 (PLCB3)
   04020 Calcium signaling pathway
    107497081 (PLCB3)
   04070 Phosphatidylinositol signaling system
    107497081 (PLCB3)
   04072 Phospholipase D signaling pathway
    107497081 (PLCB3)
   04071 Sphingolipid signaling pathway
    107497081 (PLCB3)
   04022 cGMP-PKG signaling pathway
    107497081 (PLCB3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107497081 (PLCB3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107497081 (PLCB3)
   04613 Neutrophil extracellular trap formation
    107497081 (PLCB3)
   04621 NOD-like receptor signaling pathway
    107497081 (PLCB3)
   04062 Chemokine signaling pathway
    107497081 (PLCB3)
  09152 Endocrine system
   04911 Insulin secretion
    107497081 (PLCB3)
   04922 Glucagon signaling pathway
    107497081 (PLCB3)
   04929 GnRH secretion
    107497081 (PLCB3)
   04912 GnRH signaling pathway
    107497081 (PLCB3)
   04915 Estrogen signaling pathway
    107497081 (PLCB3)
   04921 Oxytocin signaling pathway
    107497081 (PLCB3)
   04926 Relaxin signaling pathway
    107497081 (PLCB3)
   04935 Growth hormone synthesis, secretion and action
    107497081 (PLCB3)
   04918 Thyroid hormone synthesis
    107497081 (PLCB3)
   04919 Thyroid hormone signaling pathway
    107497081 (PLCB3)
   04928 Parathyroid hormone synthesis, secretion and action
    107497081 (PLCB3)
   04916 Melanogenesis
    107497081 (PLCB3)
   04924 Renin secretion
    107497081 (PLCB3)
   04925 Aldosterone synthesis and secretion
    107497081 (PLCB3)
   04927 Cortisol synthesis and secretion
    107497081 (PLCB3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107497081 (PLCB3)
   04270 Vascular smooth muscle contraction
    107497081 (PLCB3)
  09154 Digestive system
   04970 Salivary secretion
    107497081 (PLCB3)
   04971 Gastric acid secretion
    107497081 (PLCB3)
   04972 Pancreatic secretion
    107497081 (PLCB3)
   04973 Carbohydrate digestion and absorption
    107497081 (PLCB3)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    107497081 (PLCB3)
  09156 Nervous system
   04724 Glutamatergic synapse
    107497081 (PLCB3)
   04725 Cholinergic synapse
    107497081 (PLCB3)
   04728 Dopaminergic synapse
    107497081 (PLCB3)
   04726 Serotonergic synapse
    107497081 (PLCB3)
   04720 Long-term potentiation
    107497081 (PLCB3)
   04730 Long-term depression
    107497081 (PLCB3)
   04723 Retrograde endocannabinoid signaling
    107497081 (PLCB3)
  09157 Sensory system
   04742 Taste transduction
    107497081 (PLCB3)
   04750 Inflammatory mediator regulation of TRP channels
    107497081 (PLCB3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107497081 (PLCB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107497081 (PLCB3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107497081 (PLCB3)
   05016 Huntington disease
    107497081 (PLCB3)
   05017 Spinocerebellar ataxia
    107497081 (PLCB3)
   05022 Pathways of neurodegeneration - multiple diseases
    107497081 (PLCB3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107497081 (PLCB3)
   04934 Cushing syndrome
    107497081 (PLCB3)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    107497081 (PLCB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107497081 (PLCB3)
   05142 Chagas disease
    107497081 (PLCB3)
   05143 African trypanosomiasis
    107497081 (PLCB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107497081 (PLCB3)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     107497081 (PLCB3)
Membrane trafficking [BR:ray04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    107497081 (PLCB3)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    107497081 (PLCB3)
SSDB
Motif
Pfam: PI-PLC-X PLC-beta_C PH_14 PI-PLC-Y EF-hand_like C2 DUF1154 BPL_N TFIIE-A_C
Other DBs
NCBI-GeneID: 107497081
NCBI-ProteinID: XP_015974010
LinkDB
Position
Unknown
AA seq 1229 aa
MAGARPGVHALQLEPPTVGETLRRGSKFIKWDEEASSRNLVTLRVDPNGFFLYWTGPNME
VDTLDISSIRDTRTGRYARLPKDPKIREVLGFGGPDARLEEKLMTVVAGPDPVTTSFLNF
MAVQDDTAKVWAEELFKLAMNILAQNASRNTFLRKAYTKLKLQVNQDGRIPVKNILKMFS
ADKKRVETALESCGLKFNRSESIRPDEFSLEIFERFLNKLCLRPDIDKILLEIGAKGKPY
LTLEQLMDFINQKQRDPRLNEVLYPPLGSSQARQLIEKYEPNQQFLERDQMSMEGFSRYL
GGEENGILPLEALDLSADMTQPLSAYFINSSHNTYLTAGQLAGTSSVEMYRQALLWGCRC
VELDVWKGRPPEEEPFITHGFTMTTEVPLRDVLEAIAETAFKTSPYPVILSFENHVDSAK
QQAKMAEYCRSIFGDALLIDPLDKYPLAPGTPLPSPQDLMGRILVKNKKRHRPSTGGTGS
SVRKRPLEQSNSALSESSAATEPSSPQLGSPSSDSCLGLSNGEEAGLEKPSLEPQKSLGE
EGPQRAPDLGPADREDEEEDEEEEEQTDPKKPTTDEGTASSEVNATEEMSTLVNYIEPVK
FKSFEAARKRNKCFEMSSFVETKAMEHLTKSPMEFVEYNKQQLSRIYPKGTRVDSSNYMP
QLFWNVGCQLVALNFQTLDVAMQLNAGVFEYNGRSGYLLKPEFMRRPDKSFDPFTEVIVD
GIVANALRVKVISGQFLSDRKVGIYVEVDMFGLPVDTRRKYRTRTSQGNSFNPVWEEEPF
DFPKVVLPTLASLRIAAFEEGGKFVGHRILPVSAIRSGYHYICLRNEANQPLCLPALLIY
TEASDYIPDDHQDYAEALINPIKHVSLMDQRAKQLAALIGEREAQSGPETCQETQSQQLV
SQLTPNPTPSPLDTSPRRPAGPTTSPTSPALSSPGQRDDLIASILSEVPIAPLEELRGHK
TLVKLQSRQERDLRELHKKHQRKAVALTRRLLDSLAQARAEGRCRPRPGVLGGENEKEEE
EEAKRFQEFQKRQIQSLLALREAQADSETERRLEHLRQAQQRLREIVLDAHATQLKRLKE
TNDREKKELQKILDRKRHNSISEAKTREKHKKEAELTEINRRHITESVNSIRRLEEAQKQ
RHERLVAGQQQVLQQLVEEEPKLLAQLTQECQEQRARLPQEIRRSLLGETREGLGDGHLV
ACASNGHAPGSSGHLSGADSETQEENTKL
NT seq 3690 nt   +upstreamnt  +downstreamnt
atggcgggcgccaggcccggcgtccacgcgctgcagctggagccgcccaccgtgggggag
accctgcggcgcgggagtaagttcatcaaatgggacgaggaggcctccagccggaacttg
gtgactctgcgtgtggaccccaatggcttcttcctgtactggacaggacccaacatggag
gtggacacactggacatcagttccatcagggacacacggacaggccgttacgcccgtctg
cccaaggaccccaagatacgggaggtgctgggttttgggggccctgatgcccggctggag
gagaagctgatgacagtggtggctgggccagacccggtgaccacatcatttttgaacttc
atggccgtgcaggatgacacagctaaggtctgggccgaggagctgttcaaactggctatg
aacatcctggctcagaatgcctccaggaacactttcctgcgcaaagcatacacaaagctg
aagctgcaggtgaaccaggatggacggatcccggtcaagaacatcctgaagatgttctca
gcagacaaaaagcgggtggagacggcgctggagtcttgtggcctcaagtttaaccggagt
gagtccatccggccagatgagttttccttggaaatctttgagcggttcctgaataagctg
tgtctgcggccagacattgacaagatcctcctggagataggtgccaagggcaagccgtac
ctgacactggagcagctcatggacttcatcaaccaaaagcagcgggacccaagactcaac
gaagtgctgtacccacccctggggtcctcccaggcccggcagcttatcgagaagtatgag
cccaaccagcagttcctggagcgagatcagatgtccatggagggcttcagccgctacctg
ggaggtgaagagaacggcatcctgcccctagaggccctggatctgagtgcagacatgacc
cagccgctgagtgcctatttcatcaactcctcgcacaacacctatctcacagcgggacag
ctggccgggacctcgtcggtggagatgtaccggcaggcgctgctgtggggctgccgctgc
gtggagctggacgtgtggaaagggcggccgcctgaggaggagcccttcatcacccacggc
ttcaccatgaccacggaggtgccgctgcgggacgtgctcgaggccatcgcggagaccgcc
ttcaagacctcaccctaccccgtcatcctctctttcgagaaccacgtggactcggcaaag
cagcaggccaagatggctgagtattgccgctccatctttggggacgcgctgctcatcgac
ccactggacaagtacccgctggccccggggacccccctgcccagcccccaggacctgatg
ggccgcatcctggtgaagaacaagaagcggcaccggcccagcacgggcggcaccgggagc
tccgtacgcaagcggccgctggagcagagcaactcggccctgagcgagagctctgccgcc
accgagccgtcctcgccccagctcgggtcccccagctccgacagctgccttggcttgagc
aatggggaggaggcaggccttgagaagcccagcttagagcctcagaagtctctgggcgag
gagggaccccagcgggcccccgatctcggtcctgccgatcgtgaggatgaagaggaggat
gaggaagaggaggaacagacagaccccaaaaaaccgaccacagatgagggcaccgccagc
agtgaggtcaatgccactgaggaaatgtcaacactcgtcaactacatcgagcctgtcaag
ttcaagtccttcgaggctgctcgaaagaggaacaagtgctttgagatgtcatccttcgtg
gagaccaaggctatggagcatctgaccaagagccccatggagttcgtggaatacaacaag
cagcagctcagccgtatctaccccaagggcacccgtgtggactcgtccaactacatgcca
cagctcttctggaacgtgggctgccagcttgtggcactcaacttccagaccctggatgtg
gcgatgcagctcaacgcaggtgtgtttgagtacaatgggcgcagtggctacctgctcaag
cctgagttcatgcggcggccggacaagtcctttgaccccttcaccgaggtcatcgtggac
ggcattgtggccaatgccttgcgggtcaaggtgatctctgggcagttcctgtccgacagg
aaggtgggcatctatgtggaggtggacatgttcggcctccctgttgacacgcggcgcaag
taccgcacgcggacctctcaggggaactcgttcaaccccgtgtgggaggaggagcccttc
gacttccccaaggtggtgctgcctacgctggcttcgctgcgcatcgcagcttttgaggag
ggcggcaagtttgtggggcaccggatcctgcccgtctctgccatccgctcagggtaccac
tacatctgcctgcgaaacgaggccaaccagccgctgtgcctgccggccctgctcatctac
actgaggcctccgactacatccctgacgaccaccaggattatgcagaagccctgatcaac
cccatcaagcacgtcagcctgatggaccagagggccaagcagctggctgccctcattggg
gagagggaggctcagtcgggcccagagacatgccaggagacccagtcccagcagctggtg
tcccagctgaccccaaaccccacccccagcccgctggacacctccccacgcagacccgca
ggccctaccacctcccccaccagccccgccctgagcagcccaggtcagcgggatgatctc
attgccagtattctctcagaggtgccgatagccccgctggaagagctccgaggccacaag
actctggtgaagctccagagccggcaagagcgagacctgcgggagctgcacaagaagcat
cagcggaaggcggtcgccctcactcgccgattgctggacagcctggcccaggcccgggct
gagggcaggtgccgaccccggccaggcgtcctaggtggggagaacgagaaggaggaggag
gaagaggcgaaacgctttcaagagttccagaagagacagatacagagtctgctggcgctg
agggaggcccaggctgattcagagacggaaaggaggctggagcacctgagacaggcgcag
cagcggctcagggagattgtcctggatgctcacgcaactcagctcaagaggctgaaggag
acgaatgacagggagaagaaggaactgcagaagatcctggacaggaaacgtcacaacagt
atctcagaggccaagacgagggagaaacataagaaggaggcggaactgacagagattaac
cgtcggcacatcaccgagtcggtcaactccatccgtcggctggaggaggcccagaagcag
cggcatgaacgcctagtggctgggcagcagcaggtcctacagcagctcgtggaagaggag
cccaagctgctggcccagctgacccaggagtgtcaggagcagcgggcgcggctgccccag
gagatccgccggagcctgctgggcgagacacgagaggggctgggggacgggcatctggtg
gcttgtgccagcaacggtcacgcacctgggagcagcgggcacctgtctggcgctgactcg
gagacccaagaggagaatacgaagctctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107506114
Entry
107506114         CDS       T06036                                 

Gene name
PLCB1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 isoform X1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00562  Inositol phosphate metabolism
ray01100  Metabolic pathways
ray04015  Rap1 signaling pathway
ray04020  Calcium signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04062  Chemokine signaling pathway
ray04070  Phosphatidylinositol signaling system
ray04071  Sphingolipid signaling pathway
ray04072  Phospholipase D signaling pathway
ray04261  Adrenergic signaling in cardiomyocytes
ray04270  Vascular smooth muscle contraction
ray04310  Wnt signaling pathway
ray04371  Apelin signaling pathway
ray04540  Gap junction
ray04611  Platelet activation
ray04613  Neutrophil extracellular trap formation
ray04621  NOD-like receptor signaling pathway
ray04713  Circadian entrainment
ray04720  Long-term potentiation
ray04723  Retrograde endocannabinoid signaling
ray04724  Glutamatergic synapse
ray04725  Cholinergic synapse
ray04726  Serotonergic synapse
ray04728  Dopaminergic synapse
ray04730  Long-term depression
ray04742  Taste transduction
ray04750  Inflammatory mediator regulation of TRP channels
ray04911  Insulin secretion
ray04912  GnRH signaling pathway
ray04915  Estrogen signaling pathway
ray04916  Melanogenesis
ray04918  Thyroid hormone synthesis
ray04919  Thyroid hormone signaling pathway
ray04921  Oxytocin signaling pathway
ray04922  Glucagon signaling pathway
ray04924  Renin secretion
ray04925  Aldosterone synthesis and secretion
ray04926  Relaxin signaling pathway
ray04927  Cortisol synthesis and secretion
ray04928  Parathyroid hormone synthesis, secretion and action
ray04929  GnRH secretion
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray04934  Cushing syndrome
ray04935  Growth hormone synthesis, secretion and action
ray04961  Endocrine and other factor-regulated calcium reabsorption
ray04970  Salivary secretion
ray04971  Gastric acid secretion
ray04972  Pancreatic secretion
ray04973  Carbohydrate digestion and absorption
ray05010  Alzheimer disease
ray05016  Huntington disease
ray05017  Spinocerebellar ataxia
ray05022  Pathways of neurodegeneration - multiple diseases
ray05142  Chagas disease
ray05143  African trypanosomiasis
ray05146  Amoebiasis
ray05163  Human cytomegalovirus infection
ray05200  Pathways in cancer
Module
ray_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107506114 (PLCB1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107506114 (PLCB1)
   04310 Wnt signaling pathway
    107506114 (PLCB1)
   04371 Apelin signaling pathway
    107506114 (PLCB1)
   04020 Calcium signaling pathway
    107506114 (PLCB1)
   04070 Phosphatidylinositol signaling system
    107506114 (PLCB1)
   04072 Phospholipase D signaling pathway
    107506114 (PLCB1)
   04071 Sphingolipid signaling pathway
    107506114 (PLCB1)
   04022 cGMP-PKG signaling pathway
    107506114 (PLCB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107506114 (PLCB1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107506114 (PLCB1)
   04613 Neutrophil extracellular trap formation
    107506114 (PLCB1)
   04621 NOD-like receptor signaling pathway
    107506114 (PLCB1)
   04062 Chemokine signaling pathway
    107506114 (PLCB1)
  09152 Endocrine system
   04911 Insulin secretion
    107506114 (PLCB1)
   04922 Glucagon signaling pathway
    107506114 (PLCB1)
   04929 GnRH secretion
    107506114 (PLCB1)
   04912 GnRH signaling pathway
    107506114 (PLCB1)
   04915 Estrogen signaling pathway
    107506114 (PLCB1)
   04921 Oxytocin signaling pathway
    107506114 (PLCB1)
   04926 Relaxin signaling pathway
    107506114 (PLCB1)
   04935 Growth hormone synthesis, secretion and action
    107506114 (PLCB1)
   04918 Thyroid hormone synthesis
    107506114 (PLCB1)
   04919 Thyroid hormone signaling pathway
    107506114 (PLCB1)
   04928 Parathyroid hormone synthesis, secretion and action
    107506114 (PLCB1)
   04916 Melanogenesis
    107506114 (PLCB1)
   04924 Renin secretion
    107506114 (PLCB1)
   04925 Aldosterone synthesis and secretion
    107506114 (PLCB1)
   04927 Cortisol synthesis and secretion
    107506114 (PLCB1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107506114 (PLCB1)
   04270 Vascular smooth muscle contraction
    107506114 (PLCB1)
  09154 Digestive system
   04970 Salivary secretion
    107506114 (PLCB1)
   04971 Gastric acid secretion
    107506114 (PLCB1)
   04972 Pancreatic secretion
    107506114 (PLCB1)
   04973 Carbohydrate digestion and absorption
    107506114 (PLCB1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    107506114 (PLCB1)
  09156 Nervous system
   04724 Glutamatergic synapse
    107506114 (PLCB1)
   04725 Cholinergic synapse
    107506114 (PLCB1)
   04728 Dopaminergic synapse
    107506114 (PLCB1)
   04726 Serotonergic synapse
    107506114 (PLCB1)
   04720 Long-term potentiation
    107506114 (PLCB1)
   04730 Long-term depression
    107506114 (PLCB1)
   04723 Retrograde endocannabinoid signaling
    107506114 (PLCB1)
  09157 Sensory system
   04742 Taste transduction
    107506114 (PLCB1)
   04750 Inflammatory mediator regulation of TRP channels
    107506114 (PLCB1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107506114 (PLCB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107506114 (PLCB1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107506114 (PLCB1)
   05016 Huntington disease
    107506114 (PLCB1)
   05017 Spinocerebellar ataxia
    107506114 (PLCB1)
   05022 Pathways of neurodegeneration - multiple diseases
    107506114 (PLCB1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107506114 (PLCB1)
   04934 Cushing syndrome
    107506114 (PLCB1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    107506114 (PLCB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107506114 (PLCB1)
   05142 Chagas disease
    107506114 (PLCB1)
   05143 African trypanosomiasis
    107506114 (PLCB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107506114 (PLCB1)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     107506114 (PLCB1)
Membrane trafficking [BR:ray04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    107506114 (PLCB1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    107506114 (PLCB1)
SSDB
Motif
Pfam: PI-PLC-X PLC-beta_C PH_14 PI-PLC-Y EF-hand_like DUF1154
Other DBs
NCBI-GeneID: 107506114
NCBI-ProteinID: XP_015992520
LinkDB
Position
Unknown
AA seq 1216 aa
MAGAQPGVHALQLKPVCVSDSLKKGTKFVKWDDDSAIVTPIILRSDPQGFFFYWTDQNKE
TELLDLSLVKDARCGKHARAPKDPKLRELLDVGNIGRLEHRMITVVYGADLVNISYLNLV
AFQEEVAKEWTNEVFSLATNLLAQNMSRDAFLEKAYTKLKLQVTPEGRIPLKNIYRLFSA
DRKRVETALEACSLPSSRNDSIPQDDFTPEVYRVFLNNLCPRPEIDNIFSEFGAKSKPYL
TVDQMMDFINLKQRDPRLNEILYPPLKQEQVQVLIEKYEPNNSLAKKGQISVDGFMRYLS
GEENGVVSPEKLDLNEDMSQPLSHYFINSSHNTYLTAGQLAGNSSVEMYRQVLLSGCRCV
ELDCWKGRTAEEEPVITHGFTMTTEISFKEVIEAIAECAFKTSPFPILLSFENHVDSPKQ
QAKMAEYCRLIFGDALLMEPLEKYPLESGVPLPSPMDLMYKILVKNKKKSHKSSEGSNKK
KLSEQASNTYSDSSSVFEPSSPGAGEADTESDDDDDDDDCKKSSMDEGTAGSEAMATEEM
SNLVNYIQPVKFESFETSKKRNRSFEMSSFVETKGLEQLTKSPVEFVEYNKMQLSRIYPK
GTRVDSSNYMPQLFWNAGCQMVALNFQTMDLAMQINMGMYEYNGKSGYRLKPEFMRRPDK
HFDPFTEGIVDGIVANTLSVKIISGQFLSDKKVGTYVEVDMFGLPVDTRRKAFKTKTSQG
NAVNPVWEEEPIVFKKVVLPSLACLRIAVYEEGGKFIGHRILPVPAIRPGYHYICLRNER
NQPLTLPAVFVYIEVKDYVPDTYADVIEALSNPIRYVNLMEQRAKQLAALTLEDEEEVKK
EADPGETPSEAPSEARTTPAENGVNHTTSLAPKPPSQALHSQPAPGSVKAPAKTEDLIQS
VLTEVEAQTIEELKQQKSFVKLQKKHYKEMKDLVKRHHKKTTDLIKEHTTKYNEIQNDYL
RRRTALEKTAKKDSKKKSEPSSPDHGSSTIEQDLAALDAEMTQKLIDLKDKQQQQLLNLR
QEQYYSEKYQKREHIKLLIQKLTDVAEECQNNQLKKLKEICEKEKKELKKKMDKKRQEKI
TEAKSKDKSQMEEEKTEMIRSYIQEVVQYIKRLEEAQSKRQEKLVEKHKEIRQQILDEKP
KLQVELEQEYQDKFKRLPLEILEFVQEAMKGKISEDSNHSSAPSSLTSDPGQLNHKPPSS
EELEGDHPGREFDTPL
NT seq 3651 nt   +upstreamnt  +downstreamnt
atggccggggctcagcccggagtgcatgctttgcaactcaagcctgtgtgtgtgtccgac
agcctaaagaagggcaccaaattcgtcaagtgggatgatgactctgctattgttactcca
attattttgaggtctgaccctcagggatttttcttttactggacagatcaaaacaaggag
acggagctattagatctcagccttgtcaaggatgccagatgtgggaaacatgccagagct
cccaaggaccccaaattacgtgaacttttggatgtggggaatattggacgcctggaacat
cgcatgataaccgtggtgtacggggccgacttagttaacatttcctatttgaatcttgtg
gctttccaagaagaagtggccaaggaatggacaaatgaggttttcagtttggcaacaaac
ctgctggctcaaaacatgtccagggatgcatttctggaaaaagcctacactaaacttaag
ctgcaagtcactccagaagggcgcattcctctcaaaaacatataccgcttgttttcagca
gaccggaaacgagtcgaaactgctttagaggcgtgtagtcttccatcttcaaggaatgat
tcaatacctcaagatgatttcactccagaagtatacagagttttcctgaacaacctttgc
cctcgacctgaaattgataacatcttttctgaatttggtgccaaaagcaaaccatatctt
accgttgatcagatgatggattttatcaaccttaagcaacgagatcccaggctaaatgaa
atactctacccacctttaaaacaagagcaagttcaagtattgattgagaagtatgaacca
aacaatagcctcgccaaaaaaggacagatatcagtggatggatttatgcgctatctgagt
ggagaagaaaatggagttgtttcacctgagaaactggatttgaatgaagatatgtctcaa
cccctttctcactatttcattaattcctcacacaacacctacctcacagctggccagctg
gctggaaactcttctgtggagatgtatcgacaagtcctcctgtctggttgtcgctgtgtg
gagctggactgctggaaaggacggaccgcagaggaggagccagtcattacccacggcttc
accatgaccaccgaaatatccttcaaggaggtgatagaagcaatcgctgagtgtgcgttc
aagacttcaccgtttccgattcttctttcatttgagaatcacgtggattcccctaagcag
caagccaagatggcagagtattgtcgactgatctttggggatgctcttctcatggagcca
ctggaaaaatacccactggaatctggagttcctcttccaagccctatggatttaatgtac
aaaattttggtgaaaaataagaagaaatctcacaaatcatcagaaggaagtaacaaaaag
aagctctcagaacaagcctccaacacttacagtgactcctccagtgtgtttgagccctca
tcccctggggccggggaagctgatacagagagtgacgatgacgatgatgatgatgactgt
aaaaagtcttcaatggatgaggggactgctgggagcgaggctatggccacagaagagatg
tctaacctggtgaactatattcagccagtcaagtttgagtcatttgaaacttcaaaaaaa
agaaatagaagttttgaaatgtcttcttttgtggaaaccaaaggactcgagcaactgacg
aagtctccagtggaatttgtagaatataacaaaatgcagcttagcaggatatatccaaaa
ggaacacgtgtggattcatctaattatatgcctcagctcttctggaatgcgggttgtcaa
atggttgcacttaacttccaaacgatggacctggctatgcagataaacatggggatgtat
gaatacaatgggaagagtggctacagattaaagccagagttcatgaggagacctgacaag
cattttgatccattcaccgaaggcattgtagatgggatagtggccaacactttatctgtt
aagattatttcaggtcagtttctttctgataagaaagttgggacttatgtggaagtagat
atgtttggtttgcctgtggacacaaggaggaaagcgtttaagaccaagacatcacaagga
aatgctgtaaatcctgtctgggaagaagaacccattgttttcaaaaaggtggttcttcct
tctctggcctgtctgaggatagcagtttatgaagaaggaggtaaatttattggtcaccgg
atcttgccagtaccagcaattcggccaggctatcactacatctgtctgaggaatgagagg
aaccagcctctgacgctaccagctgtctttgtctacatagaggtgaaagactatgtccca
gatacatatgcagatgtgatcgaagctttgtcaaatccaattcgatatgtaaatctgatg
gagcagagagctaagcaactggctgctttgacactggaagatgaagaagaagtaaagaaa
gaggctgatcctggagagacaccgtcagaggctccgagtgaggccaggacaactccagca
gaaaatggagtgaatcacactacatccctggcacccaaaccaccttctcaggctctccac
agccaacctgctccaggttctgtaaaggcgcctgccaagacagaagatcttattcagagc
gttttaacagaagtagaagcacagactattgaagagctaaagcaacagaaatcgtttgtg
aaacttcaaaagaagcactacaaagaaatgaaagacctggttaagagacaccacaagaaa
accactgaccttatcaaagaacacactacaaaatataatgaaattcagaatgactacttg
agaaggagaacggctttagaaaagacagccaaaaaggatagtaagaaaaaatcggaaccc
agcagccctgaccacggttcatcgacgattgagcaagatcttgccgccctggatgccgaa
atgactcaaaagttaatagacttaaaggacaagcaacagcaacagctgctgaatcttcga
caagaacagtattatagtgaaaagtaccagaagcgagaacatattaaactgcttattcaa
aaactgacggatgttgctgaagaatgtcagaacaatcagttaaagaagcttaaagaaatc
tgtgagaaagagaagaaggaattaaagaagaaaatggataagaagaggcaggagaagata
acagaagctaaatccaaagacaaaagccagatggaagaggaaaagacggagatgatccga
tcgtacatccaggaggtggtgcagtacatcaagaggttagaagaggcacaaagtaaaagg
caagaaaaactcgtagagaaacacaaggagatacgtcagcagatcctggacgaaaagccc
aagctgcaggtggaactagagcaagagtaccaagataagttcaaaagactgcctctggag
attttggagttcgtgcaggaagccatgaaagggaagatcagtgaggacagcaatcacagt
tctgccccttcttccttaacctcagaccctggacaactgaaccacaagcctccctccagt
gaggagctggaaggagaccatccaggaagagaatttgatactcctctgtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107514464
Entry
107514464         CDS       T06036                                 

Gene name
PLCB2
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2 isoform X1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00562  Inositol phosphate metabolism
ray01100  Metabolic pathways
ray04015  Rap1 signaling pathway
ray04020  Calcium signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04062  Chemokine signaling pathway
ray04070  Phosphatidylinositol signaling system
ray04071  Sphingolipid signaling pathway
ray04072  Phospholipase D signaling pathway
ray04261  Adrenergic signaling in cardiomyocytes
ray04270  Vascular smooth muscle contraction
ray04310  Wnt signaling pathway
ray04371  Apelin signaling pathway
ray04540  Gap junction
ray04611  Platelet activation
ray04613  Neutrophil extracellular trap formation
ray04621  NOD-like receptor signaling pathway
ray04713  Circadian entrainment
ray04720  Long-term potentiation
ray04723  Retrograde endocannabinoid signaling
ray04724  Glutamatergic synapse
ray04725  Cholinergic synapse
ray04726  Serotonergic synapse
ray04728  Dopaminergic synapse
ray04730  Long-term depression
ray04742  Taste transduction
ray04750  Inflammatory mediator regulation of TRP channels
ray04911  Insulin secretion
ray04912  GnRH signaling pathway
ray04915  Estrogen signaling pathway
ray04916  Melanogenesis
ray04918  Thyroid hormone synthesis
ray04919  Thyroid hormone signaling pathway
ray04921  Oxytocin signaling pathway
ray04922  Glucagon signaling pathway
ray04924  Renin secretion
ray04925  Aldosterone synthesis and secretion
ray04926  Relaxin signaling pathway
ray04927  Cortisol synthesis and secretion
ray04928  Parathyroid hormone synthesis, secretion and action
ray04929  GnRH secretion
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray04934  Cushing syndrome
ray04935  Growth hormone synthesis, secretion and action
ray04961  Endocrine and other factor-regulated calcium reabsorption
ray04970  Salivary secretion
ray04971  Gastric acid secretion
ray04972  Pancreatic secretion
ray04973  Carbohydrate digestion and absorption
ray05010  Alzheimer disease
ray05016  Huntington disease
ray05017  Spinocerebellar ataxia
ray05022  Pathways of neurodegeneration - multiple diseases
ray05142  Chagas disease
ray05143  African trypanosomiasis
ray05146  Amoebiasis
ray05163  Human cytomegalovirus infection
ray05200  Pathways in cancer
Module
ray_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107514464 (PLCB2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107514464 (PLCB2)
   04310 Wnt signaling pathway
    107514464 (PLCB2)
   04371 Apelin signaling pathway
    107514464 (PLCB2)
   04020 Calcium signaling pathway
    107514464 (PLCB2)
   04070 Phosphatidylinositol signaling system
    107514464 (PLCB2)
   04072 Phospholipase D signaling pathway
    107514464 (PLCB2)
   04071 Sphingolipid signaling pathway
    107514464 (PLCB2)
   04022 cGMP-PKG signaling pathway
    107514464 (PLCB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107514464 (PLCB2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107514464 (PLCB2)
   04613 Neutrophil extracellular trap formation
    107514464 (PLCB2)
   04621 NOD-like receptor signaling pathway
    107514464 (PLCB2)
   04062 Chemokine signaling pathway
    107514464 (PLCB2)
  09152 Endocrine system
   04911 Insulin secretion
    107514464 (PLCB2)
   04922 Glucagon signaling pathway
    107514464 (PLCB2)
   04929 GnRH secretion
    107514464 (PLCB2)
   04912 GnRH signaling pathway
    107514464 (PLCB2)
   04915 Estrogen signaling pathway
    107514464 (PLCB2)
   04921 Oxytocin signaling pathway
    107514464 (PLCB2)
   04926 Relaxin signaling pathway
    107514464 (PLCB2)
   04935 Growth hormone synthesis, secretion and action
    107514464 (PLCB2)
   04918 Thyroid hormone synthesis
    107514464 (PLCB2)
   04919 Thyroid hormone signaling pathway
    107514464 (PLCB2)
   04928 Parathyroid hormone synthesis, secretion and action
    107514464 (PLCB2)
   04916 Melanogenesis
    107514464 (PLCB2)
   04924 Renin secretion
    107514464 (PLCB2)
   04925 Aldosterone synthesis and secretion
    107514464 (PLCB2)
   04927 Cortisol synthesis and secretion
    107514464 (PLCB2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107514464 (PLCB2)
   04270 Vascular smooth muscle contraction
    107514464 (PLCB2)
  09154 Digestive system
   04970 Salivary secretion
    107514464 (PLCB2)
   04971 Gastric acid secretion
    107514464 (PLCB2)
   04972 Pancreatic secretion
    107514464 (PLCB2)
   04973 Carbohydrate digestion and absorption
    107514464 (PLCB2)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    107514464 (PLCB2)
  09156 Nervous system
   04724 Glutamatergic synapse
    107514464 (PLCB2)
   04725 Cholinergic synapse
    107514464 (PLCB2)
   04728 Dopaminergic synapse
    107514464 (PLCB2)
   04726 Serotonergic synapse
    107514464 (PLCB2)
   04720 Long-term potentiation
    107514464 (PLCB2)
   04730 Long-term depression
    107514464 (PLCB2)
   04723 Retrograde endocannabinoid signaling
    107514464 (PLCB2)
  09157 Sensory system
   04742 Taste transduction
    107514464 (PLCB2)
   04750 Inflammatory mediator regulation of TRP channels
    107514464 (PLCB2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107514464 (PLCB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107514464 (PLCB2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107514464 (PLCB2)
   05016 Huntington disease
    107514464 (PLCB2)
   05017 Spinocerebellar ataxia
    107514464 (PLCB2)
   05022 Pathways of neurodegeneration - multiple diseases
    107514464 (PLCB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107514464 (PLCB2)
   04934 Cushing syndrome
    107514464 (PLCB2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    107514464 (PLCB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107514464 (PLCB2)
   05142 Chagas disease
    107514464 (PLCB2)
   05143 African trypanosomiasis
    107514464 (PLCB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107514464 (PLCB2)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     107514464 (PLCB2)
Membrane trafficking [BR:ray04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    107514464 (PLCB2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    107514464 (PLCB2)
SSDB
Motif
Pfam: PLC-beta_C PI-PLC-X PH_14 PI-PLC-Y EF-hand_like C2 Gp58 AAA_13
Other DBs
NCBI-GeneID: 107514464
NCBI-ProteinID: XP_016007687
LinkDB
Position
Unknown
AA seq 1164 aa
MSLLNPVLLPPKVKAYLSQGERFIKWDDETTIASPVILRVDPKGYYLYWTYQSKEMEFLD
ITSIRDTRFGKFAKIPKSQKLRDVFNMDFPDNNFLLKTLTVVSGPDMVDLTFHNFVSYKE
NVGKNWAEDVLALVKHPLTANAPRSTFLDKILVKLKMQLNPEGKIPVKNFFQMFPADRKR
VEAALSACHLPKGKNDAINPEDFPDSVYKSFLMNLCPRPEIDEIFTSYHAKAKPYMTKEH
LSKFINQKQRDSRLNSLLFPPVRPDQVQGLIEKYEPSGINVQRGQLSPEGMVWFLCGPEN
SVLAQDKLLLHHDMTQPLNHYFINSSHNTYLTAGQFSGLSSAEMYRQVLLAGCRCVELDC
WKGKPPDEEPIITHGFTMTTDIYFKEAIEAIAESAFKTSPYPVILSFENHVDSPRQQAKM
AEYCRVMFGDMLLTEPLEKFPLKPGTPLPSPEDLRGKILIKNKKNQFSGSASPSTEQPGG
EAEGSCPPSGPVGGDTVWTGEEGAELEEEVEEEEESGSLDEEEIKKLQSDEGTAGLEVTA
YEEMSSLVNYIQPTKFISFEFSAQKNRSYVISSFTELKAYDLLSKATVQFVDYNKRQMSR
IYPKGTRMDSSNYMPQMFWNAGCQMVALNFQTMDLPMQQNMALFEFNGQSGYLLKHEFMR
RPDKQFNPFSVDRIDVVVATTLSITVISGQFLSERSVRTYVEVELFGLPGDPKRRYRTKL
SPSTNSINPVWKEEPFVFEKILMPELASLRVAVMEEGNKFLGHRIIPINALNSGYHHLCL
HSESNMPLTMPSLFVLLEMKDYVPDTWADLTVALANPIKYFNAQDKKSVKLKEDMGGPPE
MPFPLGSPVASQVNGAAAPTSNGSAEPRTTSPEELRELKGIVKLQRRHEKELRELERRGA
RRWEELLQRGAAQLAELGPLGAAVGCRGRRLGPGKGSRKKRTLPCEETAGAAPGEGPEGM
DLRVRELRDRLELELLQQGEEQYECVLKRKEQHVAEQITKMMELAREKQAAELKTLKETS
ESDTKEVKKKLEAKRLERIQAMIKVTTDKMAQERLKREINNSHIQEVVQVIKQMTESLER
HQEKLEEKQAACLEQIREMEKQFQQEALTEYEARMKGLEAEVKESVKTCLRACFPSEAED
KPESPCGASGELCEQDPLTAKGDA
NT seq 3495 nt   +upstreamnt  +downstreamnt
atgtctctgctcaaccctgtcctgctgccccccaaggtgaaggcctatctgagccaaggg
gagcgcttcatcaaatgggacgatgaaacaacgatagcctccccagttatccttcgtgtg
gaccccaagggctattacttatactggacatatcagagtaaggagatggagtttctggat
atcaccagcatccgtgacacacgctttgggaagtttgccaagattcccaagagccagaag
ctccgggatgtcttcaacatggacttccctgacaacaacttcctgctgaagacactcact
gtggtgtctggccccgacatggtggacctcaccttccacaactttgtctcctacaaggag
aacgtgggcaagaactgggctgaagatgtactggctctggtcaagcacccactgacagct
aacgccccccgcagtaccttcttggacaagatcctggtgaagctcaagatgcagctcaac
cctgaagggaagattcctgtgaagaattttttccagatgtttcctgctgaccgcaagcgg
gtagaagctgccctcagtgcctgccacctccccaaagggaagaatgatgccatcaatcct
gaggacttcccagattctgtctacaagagtttcctcatgaacctctgtcctcggccagaa
atagatgagatcttcacttcctaccatgccaaggccaaaccctacatgaccaaggagcac
ttgagcaaattcatcaaccagaaacagagggactcccgcctcaactccttactgtttccg
ccagtgcggcctgaccaggtgcagggcctcattgaaaagtatgagcccagtggcatcaac
gtgcagaggggccagctgtcacctgagggcatggtatggtttctctgtgggcctgagaat
agtgtgctggctcaggacaagctgctactccaccatgacatgacacagccgctcaatcat
tatttcatcaactcctcacacaacacctacctgacagctggccagttctcaggcctttcc
tcggctgagatgtatcgccaggtgctgcttgctggctgccgctgtgtggagctggactgc
tggaaggggaagccccccgatgaggagcctattatcacccatggcttcaccatgaccaca
gatatctacttcaaggaagcaattgaagcgattgcagaaagtgcctttaagacctccccg
tatcctgtcattctgtcatttgaaaaccatgtggactcaccccgccaacaagccaagatg
gctgagtactgccgggtgatgtttggtgatatgctgctcacagagcccctggaaaagttc
cctctgaaaccaggcacccccctgcccagccctgaggatctccgtggcaagatcctcatc
aagaataagaagaatcagttttctggctcagcatcccccagcacagagcagccaggtgga
gaggctgagggtagctgcccacccagtggccctgtgggtggggacacagtgtggacgggt
gaggaaggggctgagctggaggaggaggtggaagaggaagaggagtcgggaagcctggat
gaagaagagataaagaagttgcagtcagatgagggcacagcgggcctggaggtgacagct
tatgaggagatgtccagcttagtcaactacattcagcccactaagttcatctcctttgag
ttctctgcccagaagaaccgaagttatgtcatctcctcattcacagagctcaaggcttat
gatcttctctccaaggccacagtgcagtttgtggattacaacaagcgccagatgagccgc
atttatcccaagggaacccgcatggactcctccaactacatgcctcagatgttttggaat
gctggttgccagatggtcgccctcaacttccagacgatggacctgcctatgcaacagaac
atggcactgtttgaattcaatgggcagagcggctacctcctcaagcatgagtttatgcgt
cggccggacaagcagttcaacccattctcggtggaccgcattgatgtggtggtagccacc
accctttccattacggtaatctctgggcagttcctgtcggaacgcagtgtgcgcacctat
gtggaagtggagctgtttggccttcctggggaccccaagagacgctatcgcaccaagctg
tcacccagtaccaactccatcaaccctgtctggaaggaggagccctttgtctttgagaag
atcttgatgcctgagttggcctccctcagggtggctgtgatggaggaaggcaacaagttt
ctcggacaccgcatcatccccatcaatgccctgaattctgggtaccaccatctgtgcctg
cacagcgagagcaacatgcccctcaccatgccttcactctttgtcttgctggagatgaag
gactatgtacctgacacgtgggcagatctcactgtggcccttgccaatcccatcaagtac
ttcaatgcccaagataagaagtctgtgaagctcaaggaagacatgggaggtccgcctgag
atgcccttccctctggggagtccagttgccagccaggtcaatggggcagctgccccaaca
agcaatggatcagcagagccgcggaccactagcccggaggagctgcgggagttgaagggc
atcgtgaagctgcagcggcggcatgagaaggagctgcgagagcttgagcggcgcggtgcg
cggcgctgggaggagctgctgcagcggggcgccgcgcagctggccgagcttgggccactg
ggcgcggcggtcggctgcaggggccgcaggctcggtccggggaagggctcgcgcaagaaa
aggactctgccctgcgaagagaccgctggggcagcgccgggtgagggtcccgagggcatg
gatctgcgtgtgcgcgagctgagggacaggctggagctggagctgctgcagcagggcgag
gagcaatatgagtgtgtcctgaagcgcaaagagcagcacgtggccgagcaaatcaccaag
atgatggagctggctagagagaaacaggctgcagagcttaagaccctcaaggagacctca
gagagtgacactaaagaggtaaagaaaaagctggaggccaagaggctggagaggatccag
gccatgatcaaggttacgacagacaagatggcccaggagaggttgaaaagagagattaac
aactcccatatccaggaggtggtgcaggtcatcaaacagatgacagagagcctggagagg
catcaggagaagctggaggagaagcaggcagcttgcctggaacagatccgggagatggaa
aagcagttccagcaggaggcactgacagaatacgaggccaggatgaagggcctggaggct
gaggtgaaggagtcagtgaagacctgcctcagggcgtgcttcccttctgaggccgaggac
aagcctgagagcccctgtggggcgtctggggagctgtgtgaacaggacccacttacagca
aagggagatgcctag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107519930
Entry
107519930         CDS       T06036                                 

Gene name
PLCB4
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 isoform X1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00562  Inositol phosphate metabolism
ray01100  Metabolic pathways
ray04015  Rap1 signaling pathway
ray04020  Calcium signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04062  Chemokine signaling pathway
ray04070  Phosphatidylinositol signaling system
ray04071  Sphingolipid signaling pathway
ray04072  Phospholipase D signaling pathway
ray04261  Adrenergic signaling in cardiomyocytes
ray04270  Vascular smooth muscle contraction
ray04310  Wnt signaling pathway
ray04371  Apelin signaling pathway
ray04540  Gap junction
ray04611  Platelet activation
ray04613  Neutrophil extracellular trap formation
ray04621  NOD-like receptor signaling pathway
ray04713  Circadian entrainment
ray04720  Long-term potentiation
ray04723  Retrograde endocannabinoid signaling
ray04724  Glutamatergic synapse
ray04725  Cholinergic synapse
ray04726  Serotonergic synapse
ray04728  Dopaminergic synapse
ray04730  Long-term depression
ray04742  Taste transduction
ray04750  Inflammatory mediator regulation of TRP channels
ray04911  Insulin secretion
ray04912  GnRH signaling pathway
ray04915  Estrogen signaling pathway
ray04916  Melanogenesis
ray04918  Thyroid hormone synthesis
ray04919  Thyroid hormone signaling pathway
ray04921  Oxytocin signaling pathway
ray04922  Glucagon signaling pathway
ray04924  Renin secretion
ray04925  Aldosterone synthesis and secretion
ray04926  Relaxin signaling pathway
ray04927  Cortisol synthesis and secretion
ray04928  Parathyroid hormone synthesis, secretion and action
ray04929  GnRH secretion
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray04934  Cushing syndrome
ray04935  Growth hormone synthesis, secretion and action
ray04961  Endocrine and other factor-regulated calcium reabsorption
ray04970  Salivary secretion
ray04971  Gastric acid secretion
ray04972  Pancreatic secretion
ray04973  Carbohydrate digestion and absorption
ray05010  Alzheimer disease
ray05016  Huntington disease
ray05017  Spinocerebellar ataxia
ray05022  Pathways of neurodegeneration - multiple diseases
ray05142  Chagas disease
ray05143  African trypanosomiasis
ray05146  Amoebiasis
ray05163  Human cytomegalovirus infection
ray05200  Pathways in cancer
Module
ray_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107519930 (PLCB4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107519930 (PLCB4)
   04310 Wnt signaling pathway
    107519930 (PLCB4)
   04371 Apelin signaling pathway
    107519930 (PLCB4)
   04020 Calcium signaling pathway
    107519930 (PLCB4)
   04070 Phosphatidylinositol signaling system
    107519930 (PLCB4)
   04072 Phospholipase D signaling pathway
    107519930 (PLCB4)
   04071 Sphingolipid signaling pathway
    107519930 (PLCB4)
   04022 cGMP-PKG signaling pathway
    107519930 (PLCB4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107519930 (PLCB4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107519930 (PLCB4)
   04613 Neutrophil extracellular trap formation
    107519930 (PLCB4)
   04621 NOD-like receptor signaling pathway
    107519930 (PLCB4)
   04062 Chemokine signaling pathway
    107519930 (PLCB4)
  09152 Endocrine system
   04911 Insulin secretion
    107519930 (PLCB4)
   04922 Glucagon signaling pathway
    107519930 (PLCB4)
   04929 GnRH secretion
    107519930 (PLCB4)
   04912 GnRH signaling pathway
    107519930 (PLCB4)
   04915 Estrogen signaling pathway
    107519930 (PLCB4)
   04921 Oxytocin signaling pathway
    107519930 (PLCB4)
   04926 Relaxin signaling pathway
    107519930 (PLCB4)
   04935 Growth hormone synthesis, secretion and action
    107519930 (PLCB4)
   04918 Thyroid hormone synthesis
    107519930 (PLCB4)
   04919 Thyroid hormone signaling pathway
    107519930 (PLCB4)
   04928 Parathyroid hormone synthesis, secretion and action
    107519930 (PLCB4)
   04916 Melanogenesis
    107519930 (PLCB4)
   04924 Renin secretion
    107519930 (PLCB4)
   04925 Aldosterone synthesis and secretion
    107519930 (PLCB4)
   04927 Cortisol synthesis and secretion
    107519930 (PLCB4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107519930 (PLCB4)
   04270 Vascular smooth muscle contraction
    107519930 (PLCB4)
  09154 Digestive system
   04970 Salivary secretion
    107519930 (PLCB4)
   04971 Gastric acid secretion
    107519930 (PLCB4)
   04972 Pancreatic secretion
    107519930 (PLCB4)
   04973 Carbohydrate digestion and absorption
    107519930 (PLCB4)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    107519930 (PLCB4)
  09156 Nervous system
   04724 Glutamatergic synapse
    107519930 (PLCB4)
   04725 Cholinergic synapse
    107519930 (PLCB4)
   04728 Dopaminergic synapse
    107519930 (PLCB4)
   04726 Serotonergic synapse
    107519930 (PLCB4)
   04720 Long-term potentiation
    107519930 (PLCB4)
   04730 Long-term depression
    107519930 (PLCB4)
   04723 Retrograde endocannabinoid signaling
    107519930 (PLCB4)
  09157 Sensory system
   04742 Taste transduction
    107519930 (PLCB4)
   04750 Inflammatory mediator regulation of TRP channels
    107519930 (PLCB4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107519930 (PLCB4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107519930 (PLCB4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107519930 (PLCB4)
   05016 Huntington disease
    107519930 (PLCB4)
   05017 Spinocerebellar ataxia
    107519930 (PLCB4)
   05022 Pathways of neurodegeneration - multiple diseases
    107519930 (PLCB4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107519930 (PLCB4)
   04934 Cushing syndrome
    107519930 (PLCB4)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    107519930 (PLCB4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107519930 (PLCB4)
   05142 Chagas disease
    107519930 (PLCB4)
   05143 African trypanosomiasis
    107519930 (PLCB4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107519930 (PLCB4)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     107519930 (PLCB4)
Membrane trafficking [BR:ray04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    107519930 (PLCB4)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    107519930 (PLCB4)
SSDB
Motif
Pfam: PI-PLC-X PH_14 PI-PLC-Y DUF1154 EF-hand_like C2 EF-hand_7 EF-hand_6
Other DBs
NCBI-GeneID: 107519930
NCBI-ProteinID: XP_015973825
LinkDB
Position
Unknown
AA seq 1206 aa
MAKPYEFNWQKEVPSFLQEGAIFDRYEEESFVFEPNCLFKVDEFGFFLTWKSEGKEGQVL
ECSLINSVRLGATPKDPKILAALEAVGKSENDLEGRIVCVCSGADLVNIGFTYMVAENPE
VTKQWVDGLRSIIHNFRANNVSPMTCLKKHWMKLAFMTNTNGKIPVRSITRTFASGKTEK
VIFQALKELGLPSGKNDEIEPAAFTYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVD
QLVSFLNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDEDLKKKGVISSDGFCRYLMSDE
NAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELD
CWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKM
SKYCEDLFGDLLLKQALESHPLEPGRPLPSPNDLKRKILIKNKRLKPEVEQKQLEALKSM
MEAGESAAPVNILEDDNEEEVENAEQEEEAHPEYKFGNELSVDDLGHKEAVANSVKKASD
DLEHENNKKGLITVEDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHVAEERNI
HYNMSSFNESVGLGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVS
LNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVI
SGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEESFVFRKVILPDLA
VLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGF
GDIVDALSDPKKFLSITEKRADQMRAMGIETSDIADVPSDTSKNDKKGKANTAKANVTPQ
SSSELRPTTTAALGSGMEAKKGIELIPQVRIEDLKQMKAYLKHLKKQQKELNSLKKKHAK
EHSTMQKLHCTQVDKIVAQYDKEKSTHEKTLEKAMKKKGGSNCLEMKKETEIKIQTLTSD
HKSKVKEIVAQHTKEWSEMINTHSAEEQEIRDLHLSQQCELLKKLLISAHEQQTQQLKLS
HDRESKEMRAHQAKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAMK
QSKEMDQLKKVQLEHLEFLEKQNEQLLKSCHAVSQTQGEGDAADGEIGSRDGPQTSNSSM
KLQNTN
NT seq 3621 nt   +upstreamnt  +downstreamnt
atggccaaaccttatgaatttaactggcaaaaggaagttccttcctttttgcaagaagga
gcaatttttgacagatacgaagaggaatcctttgtgtttgaacccaattgcctcttcaaa
gtggatgaatttggcttctttctgacctggaaaagtgaaggcaaggaaggacaagtgcta
gaatgctccctcatcaacagtgttcggttgggagccacaccaaaggatcccaaaatcctg
gctgctcttgaagctgttggaaaatccgaaaatgatctggaagggcggatagtttgtgtc
tgcagtggtgcagatctggtgaacatcggtttcacttatatggtggctgagaatccagaa
gtaactaagcaatgggtagatggcctgagatcaatcatacacaacttcagggccaacaac
gtcagtccaatgacatgcctcaagaaacactggatgaaattggcatttatgaccaacaca
aatggtaaaattccagttaggagtattactagaacctttgcatcggggaaaacagaaaag
gtgatctttcaagcactcaaggagttaggtcttcccagtggaaagaatgatgaaattgag
cctgcagcatttacttatgaaaagttctatgaactgacacaaaaaatttgtcctcggaca
gatatagaggatctttttaaaaaaatcaatggagacaaaactgattatttaacggtagac
caattagtgagctttctaaatgaacatcaacgagatcctcgcctgaatgaaattttattc
ccattttatgatgctaaaagggcaatgcagatcattgagatgtatgagcctgatgaagac
ttaaagaaaaaaggcgtcatatcaagtgatggattttgcagatatctgatgtcagatgaa
aatgcccccgtctttctagatcgtttagaactttaccaagaaatggaccatcctctggct
cactacttcatcagctcttcccacaacacctatctcactggccgacaatttggtgggaag
tcttcggtggaaatgtacagacaggttctcctggccgggtgcagatgtgtcgaacttgac
tgttgggatggaaaaggtgaagaccaagaaccgataataactcatggaaaagcaatgtgt
acagatatcctttttaaagatgttattcaagccatcaaggaaacagcatttgtcacatct
gaatatccagtaattctctcctttgaaaatcactgcagcaaataccaacagtacaagatg
tccaaatattgcgaagatctatttggggatctcctgttgaaacaagcacttgaatcacat
ccacttgaaccaggcaggcccttgccatcccccaatgacctcaaaagaaaaatacttata
aaaaataaacggctgaaacctgaagttgaacaaaaacaacttgaagctttgaaaagcatg
atggaagctggagaatccgctgccccggttaacattttagaggatgataatgaagaagaa
gtagaaaatgctgagcaagaggaggaagctcaccctgaatacaaatttggaaatgaactt
tctgtggatgacttgggtcacaaggaagctgttgcaaatagtgtcaagaaggcttctgat
gacctcgaacatgaaaacaacaaaaagggcctgattactgtagaagatgagcaggcgtgg
atggcatcttataaatatgtaggtgctaccactaatatccatccgtatttgtccacaatg
atcaactatgcacagcctgtaaagtttcaaggtttccatgtggctgaagaacgcaatatt
cattataacatgtcttcttttaatgagtcagtcggtctaggctacttgaagacacacgcg
attgaatttgtgaattataacaaacggcaaatgagtcgcatttaccccaagggaggccga
gtcgattccagtaattacatgcctcagattttctggaacgctggctgccagatggtttca
ctgaactatcaaaccccagatttagcgatgcaattgaatcagggaaaatttgagtataat
ggatcatgcgggtaccttctcaaaccggatttcatgaggcggcctgatcgaacatttgat
cccttctctgaaactcctgttgacggtgttattgcagccacctgctcagtgcaggtcata
tcaggtcagttcttatcagataagaaaattggcacatatgtagaagtggatatgtatggg
ttgcccaccgacactatacgtaaggaatttcgaactcgcatggtgatgaacaatgggctc
aatccagtttacaatgaagaatcatttgtatttcggaaggtaatcctccctgacctggca
gtcttgagaatagcagtgtatgatgacaacaacaagctgattggccagaggattcttcca
ctggatggccttcaggcaggctatcgacacatttcccttcgaaacgagggaaataagcca
ttatcgttgccaacaattttctgcaatattgttcttaaaacatatgtgcctgatggattt
ggagatattgtggatgctttatcagatccaaagaagtttctttcaattacagaaaagagg
gcagaccaaatgagagctatgggcattgaaaccagtgacatagccgatgtgcccagtgac
acttctaagaatgacaagaaaggaaaggccaacactgccaaagcaaatgtgaccccacag
agcagctcagagctcagaccaaccaccacagccgccctggggtctggcatggaagccaaa
aaaggtattgaacttatccctcaagtgaggatagaagatttaaagcaaatgaaggcttac
ttgaagcatttaaagaaacaacagaaggagctaaattctttaaagaagaagcatgcaaag
gagcacagtaccatgcagaagttacattgcacacaagttgacaaaattgtggcacaatat
gacaaggagaagtcgactcatgagaaaactctagagaaggcaatgaagaaaaagggggga
agtaattgtcttgagatgaaaaaagaaacagaaattaaaattcagacactgacatcagat
cacaaatctaaggtcaaagagatcgtggcacaacacaccaaggagtggtcagaaatgatc
aacactcacagtgctgaggagcaagaaatccgggacctgcacctcagccagcagtgcgag
ctgctgaaaaagctcctgatcagtgcccacgagcagcaaacccagcagctgaaattgtcc
cacgacagggaaagcaaggaaatgagagcacaccaagctaagatttctatggaaaatagc
aaagccatcagccaagataaatctatcaagaataaagcagaacgagaaaggcgagttagg
gagttaaacagcagcaacactaagaagtttctggaagaaagaaagagacttgcaatgaaa
cagtccaaagaaatggatcagttgaaaaaagtccagcttgaacacctagaattcctagag
aaacagaatgaacagcttttgaaatcctgtcatgcagtgtcccaaactcaaggcgaagga
gatgcagcagatggtgaaattggaagccgagatggaccgcagaccagcaacagtagtatg
aaactccaaaacacaaactga

DBGET integrated database retrieval system