KEGG   Rousettus aegyptiacus (Egyptian rousette): 107497091
Entry
107497091         CDS       T06036                                 

Gene name
BAD
Definition
(RefSeq) bcl2-associated agonist of cell death
  KO
K02158  Bcl-2-antagonist of cell death
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray01522  Endocrine resistance
ray01524  Platinum drug resistance
ray04012  ErbB signaling pathway
ray04014  Ras signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04024  cAMP signaling pathway
ray04062  Chemokine signaling pathway
ray04140  Autophagy - animal
ray04151  PI3K-Akt signaling pathway
ray04210  Apoptosis
ray04370  VEGF signaling pathway
ray04510  Focal adhesion
ray04722  Neurotrophin signaling pathway
ray04910  Insulin signaling pathway
ray04919  Thyroid hormone signaling pathway
ray05010  Alzheimer disease
ray05014  Amyotrophic lateral sclerosis
ray05020  Prion disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05145  Toxoplasmosis
ray05152  Tuberculosis
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05162  Measles
ray05165  Human papillomavirus infection
ray05168  Herpes simplex virus 1 infection
ray05170  Human immunodeficiency virus 1 infection
ray05200  Pathways in cancer
ray05203  Viral carcinogenesis
ray05210  Colorectal cancer
ray05211  Renal cell carcinoma
ray05212  Pancreatic cancer
ray05213  Endometrial cancer
ray05215  Prostate cancer
ray05218  Melanoma
ray05220  Chronic myeloid leukemia
ray05221  Acute myeloid leukemia
ray05223  Non-small cell lung cancer
ray05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107497091 (BAD)
   04014 Ras signaling pathway
    107497091 (BAD)
   04370 VEGF signaling pathway
    107497091 (BAD)
   04024 cAMP signaling pathway
    107497091 (BAD)
   04022 cGMP-PKG signaling pathway
    107497091 (BAD)
   04151 PI3K-Akt signaling pathway
    107497091 (BAD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107497091 (BAD)
  09143 Cell growth and death
   04210 Apoptosis
    107497091 (BAD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107497091 (BAD)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    107497091 (BAD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107497091 (BAD)
   04919 Thyroid hormone signaling pathway
    107497091 (BAD)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107497091 (BAD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107497091 (BAD)
   05203 Viral carcinogenesis
    107497091 (BAD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107497091 (BAD)
   05212 Pancreatic cancer
    107497091 (BAD)
   05225 Hepatocellular carcinoma
    107497091 (BAD)
   05221 Acute myeloid leukemia
    107497091 (BAD)
   05220 Chronic myeloid leukemia
    107497091 (BAD)
   05218 Melanoma
    107497091 (BAD)
   05211 Renal cell carcinoma
    107497091 (BAD)
   05215 Prostate cancer
    107497091 (BAD)
   05213 Endometrial cancer
    107497091 (BAD)
   05223 Non-small cell lung cancer
    107497091 (BAD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107497091 (BAD)
   05014 Amyotrophic lateral sclerosis
    107497091 (BAD)
   05020 Prion disease
    107497091 (BAD)
   05022 Pathways of neurodegeneration - multiple diseases
    107497091 (BAD)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107497091 (BAD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107497091 (BAD)
   05161 Hepatitis B
    107497091 (BAD)
   05160 Hepatitis C
    107497091 (BAD)
   05162 Measles
    107497091 (BAD)
   05168 Herpes simplex virus 1 infection
    107497091 (BAD)
   05165 Human papillomavirus infection
    107497091 (BAD)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107497091 (BAD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107497091 (BAD)
   01524 Platinum drug resistance
    107497091 (BAD)
   01522 Endocrine resistance
    107497091 (BAD)
SSDB
Motif
Pfam: Bcl-2_BAD Bclx_interact
Other DBs
NCBI-GeneID: 107497091
NCBI-ProteinID: XP_015974042
LinkDB
Position
Unknown
AA seq 168 aa
MFQIPEFEQSEQEDCRAADRGLGPSLTGDQPPGFSKYRCSASGHLGEAGHQQGQPTSSSH
HGGAGSLEARSRHSSYPAGNQEDEEAEEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSD
EFDGSFKGLPRPKSAGTATQMRQNSSWTRIIQSWWDRNLGRGGSAPSQ
NT seq 507 nt   +upstreamnt  +downstreamnt
atgttccagatcccagagtttgagcagagtgagcaggaagactgcagagctgcagatagg
ggcctgggccccagcctcacaggggaccagcccccaggcttcagcaagtaccggtgttcg
gcctcaggccacctgggggaagctggtcaccagcaggggcagccaaccagcagcagccac
catggaggcgctgggtctttggaggccaggagtcgccatagctcgtaccccgccgggaac
caggaagacgaagaagcagaggaggaggagcccagcccctttcggggacgctcacgttca
gcgccccccaacctctgggctgcacagcgctatggccgtgagctccggaggatgagcgat
gagttcgacggttccttcaagggacttcctcgcccgaaaagcgcgggcacagcaacacag
atgcggcagaactccagctggactcgcatcatccagtcctggtgggatcggaacttgggg
agaggaggctccgccccctcccaatga

DBGET integrated database retrieval system