KEGG   Rousettus aegyptiacus (Egyptian rousette): 107497138
Entry
107497138         CDS       T06036                                 

Gene name
MEF2C
Definition
(RefSeq) myocyte-specific enhancer factor 2C isoform X1
  KO
K04454  MADS-box transcription enhancer factor 2C
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04371  Apelin signaling pathway
ray04921  Oxytocin signaling pathway
ray04928  Parathyroid hormone synthesis, secretion and action
ray05202  Transcriptional misregulation in cancer
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107497138 (MEF2C)
   04371 Apelin signaling pathway
    107497138 (MEF2C)
   04022 cGMP-PKG signaling pathway
    107497138 (MEF2C)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107497138 (MEF2C)
   04928 Parathyroid hormone synthesis, secretion and action
    107497138 (MEF2C)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    107497138 (MEF2C)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107497138 (MEF2C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ray03000]
    107497138 (MEF2C)
Transcription factors [BR:ray03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   MADS-box regulators of differentiation, MEF-2
    107497138 (MEF2C)
SSDB
Motif
Pfam: SRF-TF HJURP_C
Other DBs
NCBI-GeneID: 107497138
NCBI-ProteinID: XP_015974161
LinkDB
Position
Unknown
AA seq 473 aa
MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQYAST
DMDKVLLKYTEYNEPHESRTNSDIVETLRKKGLNGCDSPDPDADDSVGHSPESEDKYRKI
NEDIDLMISRQRLCAVPPPNFEMPVSIPVSSHNSLVYSNPVSSLGNPNLLPLAHPSLQRN
SMSPGVTHRPPSAGNTGGLMGGDLTSGAGTSAGNGYGNPRNSPGLLVSPGNLNKNMQAKS
PPPMNLGMNNRKPDLRVLIPPGSKNTMPSVSEDVDLLLNQRINNSQSAQSLATPVVSVAT
PTLPGQGMGGYPSAISTTYGTEYSLSSADLSSLSGFNTASALHLGSVTGWQQQHLHNMPP
SALSQLGACTSTHLSQSSNLSLPSTQSLNIKSEPVSPPRDRTTTPSRYPQHTRHEAGRSP
VDSLSSCSSSYDGSDREDHRNEFHSPIGLTRPSPDERESPSVKRMRLSEGWAT
NT seq 1422 nt   +upstreamnt  +downstreamnt
atggggagaaaaaagattcagattacgaggattatggatgaacgtaacagacaggtgaca
tttacgaagaggaaatttgggttgatgaagaaggcatatgagctgagcgtgctgtgtgac
tgtgagatcgcgctgatcatcttcaacagcaccaacaagctgttccagtacgccagcact
gatatggacaaggtgctgcttaaatacacggagtacaacgagccacacgagagccggaca
aactcagacatcgtggagacattgagaaagaagggccttaatggctgtgacagcccagat
cccgatgcagacgattcagtaggtcacagccctgagtctgaggacaagtacaggaaaatt
aacgaagatattgatctaatgatcagcaggcaaagattgtgtgctgttccaccccccaac
tttgagatgccagtctccatcccagtgtccagccataacagtttggtatatagcaacccc
gtcagctcactgggaaaccccaaccttttgccactggcccacccttctctgcagaggaat
agcatgtctcctggtgtaacacatcgacctccgagtgcaggtaacacaggtggtctgatg
ggtggagacctcacatccggtgcaggcaccagtgcagggaatgggtatggcaatccccga
aactcaccaggtctgctggtctcacctggtaacttgaacaagaatatgcaagcaaaatct
cctccccccatgaatttagggatgaataaccgtaaaccagatctccgagttcttattcca
ccaggcagcaagaatacgatgccatcagtgtctgaggatgttgacctgcttttgaatcaa
aggataaataactcccagtctgctcagtcattggctaccccagtggtttccgtagcaact
cctactttaccaggacaagggatgggaggatatccatcagccatttcaacaacatatggt
accgagtactctctgagtagtgcggacctgtcatctctgtctgggtttaacaccgccagc
gctcttcacctgggctcagtaactggctggcaacagcaacacctacataacatgccgcca
tctgccctcagtcagctgggagcttgcactagcactcatttatctcagagttcaaatctc
tccctgccttctactcaaagcctcaacatcaagtcagaacctgtttctcctcctagagac
cgtaccaccaccccttcgagatacccacaacacacgcgccacgaggcggggagatctcct
gttgacagcttgagcagctgtagcagttcgtacgacgggagcgaccgagaggatcaccgg
aacgaattccactcccccattggactcaccagaccttcgccggacgaaagggaaagtccc
tcagtcaagcgcatgcgactctctgaaggatgggcaacatga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107503726
Entry
107503726         CDS       T06036                                 

Definition
(RefSeq) myocyte-specific enhancer factor 2B-like isoform X1
  KO
K09261  MADS-box transcription enhancer factor 2B
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04022  cGMP-PKG signaling pathway
ray04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107503726
   04022 cGMP-PKG signaling pathway
    107503726
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ray03000]
    107503726
Transcription factors [BR:ray03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   MADS-box regulators of differentiation, MEF-2
    107503726
SSDB
Motif
Pfam: SRF-TF
Other DBs
NCBI-GeneID: 107503726
NCBI-ProteinID: XP_015987903
LinkDB
Position
Unknown
AA seq 410 aa
MLPLKATAPRNHPHPPQSDPRRDLEVLWPLQSDQDHSAQSGTMGRKKIQISRILDQRNRQ
VTFTKRKFGLMKKAYELSVLCDCEIALIIFNSANRLFQYASTDMDRVLLKYTEYSEPHES
RTNTDILETLKRRGVGLDGPELEPDEGPEGPAEKLRRLAGDGGDPALPRPRLYPAAPTMP
SPDMAYGALPPPGCDSSGLGEALPAQSRPSPFRPAAPKAGPPGLAHPLFSPSHLASKTPP
PLYLAADGRRPDLPGGLAGARGGLSTSRGLYGSLQSPCSAAAPGPPLGSFPFLPAGPPEY
GLGDPPPPPGLLQPPTLAPWQPSRGDGPLTAPAQPSGGRSLGDEGPPARGASPPTPSVSI
KSERLSPAPGGPGDFPKTFPYPLLLARPLAEPLRPGPPLRRLPTADGWPR
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgctgccactcaaggccacagccccaaggaaccacccacaccctcctcagtctgatccc
agaagagacttggaggtactttggcccctccaatcagaccaagatcactctgcccagtct
gggacaatggggaggaaaaaaatacagatctcacgcattctggaccaaaggaatcggcag
gtaacatttaccaagaggaagtttgggttgatgaagaaggcctacgagctgagcgtgctc
tgtgactgtgagatcgccctcatcatcttcaacagtgccaaccgcctcttccagtatgcc
agcacggacatggaccgagtgctcctgaaatacacagagtacagtgagccccacgagagc
cgcaccaacactgacatcctcgagacactgaagcggaggggtgtgggcctcgatggacca
gagctggagcccgatgaggggcctgaggggccggcagagaagctgcggaggctggcaggt
gacgggggtgacccagccttgcccagacccaggctctatccagcagcccctactatgccc
agcccagacatggcatatggggccctgcccccaccaggctgtgactctagtgggctcggg
gaggccctccctgcccagagccgcccatcccccttccggccggcagctcccaaagccggg
cccccaggcctagcccaccctctcttctcaccaagtcaccttgccagcaagacaccacca
cccctatacctggcagcagatgggcgaaggccagacctgcctggtggcctggcaggagcc
cgagggggactgagtacctcgagaggcctctatggtagcctgcagagtccgtgctcagct
gcagccccgggacccccactgggaagctttcccttcctcccggcaggccccccagaatat
ggactaggagacccccctccgccccccggcttgctgcagccccccaccctggccccctgg
cagccctccagaggtgatgggcctctaactgcccctgcccaacccagtgggggccgcagc
ctgggcgatgagggtcccccagcccgtggtgcctccccgccaaccccgtcagtcagcatc
aagtctgagcgcctctcgccggctcccgggggccctggcgactttcccaagaccttcccc
taccccttgctcctggcccggcccctggcagagcccctacgacccgggccccccctgcgc
cggctgcccactgctgatggctggccccggtag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107515794
Entry
107515794         CDS       T06036                                 

Gene name
MEF2A
Definition
(RefSeq) myocyte-specific enhancer factor 2A isoform X1
  KO
K09260  MADS-box transcription enhancer factor 2A
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04022  cGMP-PKG signaling pathway
ray04371  Apelin signaling pathway
ray04928  Parathyroid hormone synthesis, secretion and action
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107515794 (MEF2A)
   04022 cGMP-PKG signaling pathway
    107515794 (MEF2A)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    107515794 (MEF2A)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107515794 (MEF2A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ray03000]
    107515794 (MEF2A)
Transcription factors [BR:ray03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   MADS-box regulators of differentiation, MEF-2
    107515794 (MEF2A)
SSDB
Motif
Pfam: SRF-TF HJURP_C
Other DBs
NCBI-GeneID: 107515794
NCBI-ProteinID: XP_016010417
LinkDB
Position
Unknown
AA seq 489 aa
MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYAST
DMDKVLLKYTEYNEPHESRTNSDIVEALNKKEHRGCDSPDPDTSYVLTPHTEEKYKKINE
EFDNMMRNHKIAPGLPPQNFSMSVTVPVSSPNALSYTNPGSALVSPSLAASSTLADSSML
SPPQATLHRNVSPGAPQRPPSTGSAGGMLSTSDLTVPNGAGSSPVGNGFVNSRASPNLLG
TTGANSLGKVMPTKSPPPPGSGSLAASSRKPELRVVIPPSGKGAMPPLSEEEELELNTQR
ISSSQAAQPLATPVVSVTTPSLPPQGLVYSAMPTAYNTDYSLSSADLSALQGFGSPGMLS
LGQVSAWQQQHLGPAALSSLVSGGQLSQGSNLSINTNQNINIKSEPISPPRDRMTPSGFQ
PQPQPLQPRQDMGRSPVDSLSSSSSSYDGSDREDPRGDFHAPVVLGRPPHAEDRASPSGK
RMRMDAWVT
NT seq 1470 nt   +upstreamnt  +downstreamnt
atggggcggaagaaaatacaaatcacacgcataatggatgaaaggaaccggcaggtcact
tttacaaagagaaagtttgggttaatgaagaaagcctatgaactcagcgtgctctgtgac
tgtgaaatagcactcatcatcttcaacagctccaacaagctgttccagtacgccagcacc
gacatggacaaagtgctcctcaagtacacggagtacaacgagccgcacgagagcagaacc
aactccgacatcgtcgaggctctgaacaagaaggaacacagagggtgcgacagcccagac
cctgacacttcctatgtgctcacgccacatacagaagaaaaatataaaaaaattaatgag
gagtttgataatatgatgaggaatcataagatcgcacccggtttgccacctcagaacttc
tcaatgtctgtcacagtccccgtgagcagcccgaatgctttgtcctacactaacccaggg
agtgcgcttgtgtccccgtctttggcagccagctccacattagcagattcgagcatgctc
tcaccgcctcaggccacgctacatagaaacgtgtcccctggagcccctcagagaccgccc
agcacgggcagtgcaggtgggatgttgagcacttcagacctcacagtgccaaacggagcc
ggaagcagcccggtcgggaacggattcgtaaactcaagagcttctccaaatttgctcgga
accactggtgcaaatagtctcggcaaagtcatgcccacgaagtccccgccgcccccgggc
agcggcagcctggccgcgagcagccgcaagccggagctgcgcgtcgtcatcccgccttcg
ggcaagggcgcgatgcccccgctgtcggaggaagaggaattggaattgaatacccaaagg
ataagcagttcccaagccgcgcagcctctcgccaccccggtggtgtccgtgacgaccccg
agcctgcccccgcaggggctggtgtactcggcgatgcccaccgcctacaacactgattac
tcgctgagcagcgcggacctgtcggccttgcagggcttcggctccccaggaatgctgtct
ctgggacaggtgtcggcctggcagcagcagcatttaggaccagcagccctcagctccttg
gtttccggagggcagttatctcagggttcgaatttatccattaacaccaaccaaaacatc
aacattaagtcagaaccgatttcacctccccgggatcgaatgaccccgtcgggcttccag
ccgcagccgcagcccctgcagccccggcaggacatggggcgctcccccgtggacagtctg
agcagctctagcagctcctacgacggcagtgaccgggaggacccccggggcgacttccac
gctccggtggtgctgggccggcccccacacgcggaggaccgcgccagcccctcggggaag
cgcatgaggatggacgcgtgggtcacctag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107521491
Entry
107521491         CDS       T06036                                 

Gene name
MEF2D
Definition
(RefSeq) myocyte-specific enhancer factor 2D isoform X1
  KO
K09262  MADS-box transcription enhancer factor 2D
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04022  cGMP-PKG signaling pathway
ray04371  Apelin signaling pathway
ray04928  Parathyroid hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107521491 (MEF2D)
   04022 cGMP-PKG signaling pathway
    107521491 (MEF2D)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    107521491 (MEF2D)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ray03000]
    107521491 (MEF2D)
   04131 Membrane trafficking [BR:ray04131]
    107521491 (MEF2D)
Transcription factors [BR:ray03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   MADS-box regulators of differentiation, MEF-2
    107521491 (MEF2D)
Membrane trafficking [BR:ray04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    107521491 (MEF2D)
SSDB
Motif
Pfam: SRF-TF HJURP_C
Other DBs
NCBI-GeneID: 107521491
NCBI-ProteinID: XP_016021708
LinkDB
Position
Unknown
AA seq 513 aa
MGRKKIQIQRITDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNHSNKLFQYAST
DMDKVLLKYTEYNEPHESRTNADIIETLRKKGFNGCDSPEPDGEDSLEQSPLLEDRCRRA
SEELDGLFRRYGSAVPAPNFAMPVTVPVSSQSSLQFSNPSGSLVTPSLVTSSLTDPRLLS
PQQPALQRNSVSPGLPQRPASAGAMLGGDLSSANGACPSPVGNGYVSARASPGLLPVANG
NSLNKVVPAKSPPPPTHSAQLGAPSRKPDLRVITSQGGKGLMHHLTEDHLDLNNAQRLGA
SQSTHSLTTPVVSVATPSLLSQGLPFSSMPTAYNTDYQLTSAELSSLPAFSSPGGLSLGN
VTAWQQPPQPQQPPQPQPPQPQPQPQPPQPPQPQPQSHLVPVSLSNLLPGSPLPHVGAAL
TVTTHPHISIKSEPVSPSRERSPAPPPSAVFPAARPEPGDGLSSPAGGSYEPGDQDDGRA
DFGPTLGLLRPAPEPEAEGSAVKRMRLDTWTLK
NT seq 1542 nt   +upstreamnt  +downstreamnt
atggggaggaaaaagattcagatccagcgaatcaccgatgagcggaaccgacaggtgacg
ttcaccaagcggaagttcgggctgatgaagaaggcctacgagctgagcgtgctgtgcgac
tgcgagatcgccctcatcatcttcaaccactccaacaagctgttccagtacgccagcacc
gacatggacaaggtgctgctcaagtacacggagtacaacgagccccacgagagccgcacc
aacgccgacatcatcgagaccctcaggaagaagggcttcaacggctgcgacagcccggag
cccgacggggaggactcgctggagcagagcccgctgctggaggacaggtgccggcgggcc
agcgaggagctggacgggctcttccggcgctacgggtcagccgtcccggcccccaacttt
gccatgcccgtgacggtgcctgtgtccagccagagctcgctgcagttcagcaaccccagc
ggctccttggtcaccccctccctggtgacgtcatccctcacggacccacggctcctgtcc
ccccagcagccagccctgcagaggaacagcgtgtcccccggcctgccccagcggccagcc
agtgccggggccatgctggggggagacctcagcagtgcgaacggagcctgccccagccct
gtggggaacggctacgtcagcgcccgggcctcccctggcctgctcccggtggccaatggc
aacagcttaaacaaggtcgtccccgccaagtctccgcccccacccacccacagcgcccag
ctcggagcccccagccgcaagcccgacctgagggtcatcacgtcccagggaggaaagggg
ttaatgcaccacttgaccgaggaccacttagacctgaacaacgcccagcgcctcggggcc
tcccagtccacgcactcgctcaccacacccgtggtctccgtggctacgcccagcttgctc
agccaggggctccccttctcttccatgcccaccgcctacaacacagattaccagctgacg
agtgcggagctgtcgtccttgccagccttcagctcgcctggggggctgtcgcttggcaac
gtcaccgcctggcagcagccgccgcagccccagcagcccccccagccgcagcccccgcag
ccccagccgcagccgcagccgccgcagccgccgcagccgcagccgcagtcacacctggtc
cccgtgtccctcagcaacctcctccctggcagccccctgccccacgtgggcgctgccctc
accgtcaccacccacccccatatcagcatcaagtcggaaccggtgtccccaagccgtgag
cgcagccccgcgccgcccccttcagccgtgttcccggctgcccgcccggagcctggcgac
ggcctcagcagcccagccgggggctcctacgagccgggggaccaggacgacggccgggcg
gacttcgggcccacgctgggcctgctgcgcccggccccggagcccgaggccgagggctcg
gccgtgaagaggatgcggctggacacctggacattaaagtga

DBGET integrated database retrieval system