KEGG   Rousettus aegyptiacus (Egyptian rousette): 107497163
Entry
107497163         CDS       T06036                                 

Gene name
PDGFRB
Definition
(RefSeq) platelet-derived growth factor receptor beta
  KO
K05089  platelet-derived growth factor receptor beta [EC:2.7.10.1]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04020  Calcium signaling pathway
ray04072  Phospholipase D signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04510  Focal adhesion
ray04540  Gap junction
ray04630  JAK-STAT signaling pathway
ray04810  Regulation of actin cytoskeleton
ray05165  Human papillomavirus infection
ray05200  Pathways in cancer
ray05206  MicroRNAs in cancer
ray05214  Glioma
ray05215  Prostate cancer
ray05218  Melanoma
ray05230  Central carbon metabolism in cancer
ray05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107497163 (PDGFRB)
   04014 Ras signaling pathway
    107497163 (PDGFRB)
   04015 Rap1 signaling pathway
    107497163 (PDGFRB)
   04630 JAK-STAT signaling pathway
    107497163 (PDGFRB)
   04020 Calcium signaling pathway
    107497163 (PDGFRB)
   04072 Phospholipase D signaling pathway
    107497163 (PDGFRB)
   04151 PI3K-Akt signaling pathway
    107497163 (PDGFRB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107497163 (PDGFRB)
   04540 Gap junction
    107497163 (PDGFRB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107497163 (PDGFRB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107497163 (PDGFRB)
   05206 MicroRNAs in cancer
    107497163 (PDGFRB)
   05230 Central carbon metabolism in cancer
    107497163 (PDGFRB)
   05231 Choline metabolism in cancer
    107497163 (PDGFRB)
  09162 Cancer: specific types
   05214 Glioma
    107497163 (PDGFRB)
   05218 Melanoma
    107497163 (PDGFRB)
   05215 Prostate cancer
    107497163 (PDGFRB)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107497163 (PDGFRB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107497163 (PDGFRB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107497163 (PDGFRB)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ray04090]
    107497163 (PDGFRB)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     107497163 (PDGFRB)
Protein kinases [BR:ray01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   107497163 (PDGFRB)
CD molecules [BR:ray04090]
 Proteins
  107497163 (PDGFRB)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 ig I-set Ig_2 V-set Ig_6
Other DBs
NCBI-GeneID: 107497163
NCBI-ProteinID: XP_015974233
LinkDB
Position
Unknown
AA seq 1110 aa
MLLLSAVPAPVPKGQVLLLPLLVLLGPQVSQGLVITPSEPEIVLNVSSTFVLTCSGPAPV
MWKRMMPKQLPQELTETPDGNFSSVLTLTNVNGSDTGEYFCTYNDSHGLEDGEQKRLYIF
VPDPNMGFLPVYPEEVFIFLTEVTEITIPCRVTDPQLVVTLHEKKVDVPLPFPYDHQRGF
SGTFEDKTYVCKTIIGDKEVDSEAYYVYSLQASSINISMNAVQTVVRQGENITITCIVTG
NEVVNFEWMYPRKESGRLVEPVTDFDTPSHIRSILHIPSVELGDSGTYICNVSESVYDHG
DEKAINVTVVESGYVHLLEELDAVQFAELHRSRTLQVVFEAYPPPTVMWLKDNRTLGDSS
AGEIALSTRNVSETRYVSELTLVRVKVAEAGHYTMRAFHEDAEAQLSFQLQINVPARVLE
LSESHPANGEQTVRCRGRGMPRPHLTWSTCGDLKRCPRELPPTPLGNSSEESQLETNVTY
WAEEQEFEVVSMLRLSHVDQPLSVRCTLRNLLGHDVQEVTLVPQSSPFKVVVISAILALV
VLVIISFFILIMLWQKKPRYEIRWKVIESVSSDGHEYIYVDPMQLPYDSTWELPRDQLVL
GRTLGSGAFGQVVEATAHGLSHSQATMKVAVKMLKSTARSSEKQALMSELKIMSHLGPHL
NVVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTFLQHCSDKGRRASAELYSNALPV
GLPLPSHMSLPGESDGGYMDMSKDESVDYVPMLDMKGDIKYADIESSNYMAPYDNYVPSA
PERTCRATLINESPVLSYTDLVGFSYQVANGMEFLASKNCVHRDLAARNVLICEGKLVKI
CDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWEIFTLGGT
PYPELPMNEQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFEIRPPFSQLVLLLERLL
GEGYKKKYQQVDEEFLRSDHPAVLRSQARLPGFHGLRSPLHTSSVLYTAVQPNEGDNDYI
IPLPDPKPEAADEGPLEGSPSLASSTLNEVNTSSTISCDSPLEPQEEPDPEPQPEPQVEP
ELEPGPELEQEWPPDSSCPGPRAEAEESFL
NT seq 3333 nt   +upstreamnt  +downstreamnt
atgctgcttctgagtgccgtgccagctcctgtccccaaaggccaggtgctgttgctgccc
ctgctggtgttgctgggaccgcaggtctcccaaggtctggtcatcacaccctcagagcca
gagattgtcctcaatgtctccagcaccttcgttctgacttgctcgggtccagctccggtg
atgtggaaacggatgatgcccaagcagctcccgcaagaactgactgagaccccggatggc
aacttctccagcgtactgacgctgaccaatgtcaatgggtcggacacaggggaatacttt
tgtacctacaatgactcccatgggctggaggatggtgagcaaaaacggctctatatcttc
gtgccagatcccaacatgggctttcttcctgtgtaccctgaggaagtattcatctttctc
acggaagtaactgagatcacgattccatgccgagtgacggatccacaactggtggtgacg
ctgcatgagaagaaggtggatgtccccctgcctttcccctacgaccaccaacgtggcttc
tctgggacctttgaagacaagacctatgtctgcaaaaccatcatcggggacaaagaggtg
gattccgaagcctactacgtctacagcctccaggcatcatccatcaacatctcaatgaat
gcagtgcagaccgtggtccgccagggtgagaacatcactatcacatgcatcgtgactggg
aacgaggtggtcaactttgagtggatgtacccccgcaaggagagtgggcggctggtggag
ccagtgaccgactttgatacgccctcccacatacgctccatcctgcacatccccagtgtc
gagctgggtgactcgggcacctatatctgcaatgtatcagagagtgtgtacgaccacgga
gatgaaaaggccatcaatgtcaccgtggttgagagtggctacgtgcacttgctggaggag
ctggatgctgtacaattcgcagagctgcaccggagccgaacactgcaggtggtgttcgaa
gcctacccgccacccactgtcatgtggctcaaggacaaccgcaccctgggcgactccagc
gctggcgagatcgccctgtctacgcgcaatgtgtcggagactcggtacgtgtcagaactg
acattggtgcgggtgaaggtggctgaggctggtcactacaccatgagggccttccatgag
gacgctgaggcccaactctccttccagctgcaaattaacgtgcctgcccgtgtgctggag
ctgagcgagagccaccctgccaacggggagcagacagtccgctgtcgcggccggggcatg
ccccggccacacctcacctggtctacctgcggtgacctcaaaaggtgtccgcgcgagctg
ccacccacgccactggggaacagttccgaggagagccagctggagacaaacgtaacgtac
tgggcggaggagcaggagtttgaggtggtgagcatgctgcgcctgagccatgtggatcag
ccgctgtctgtgcgctgcacgctgcgcaacctgctgggccatgacgtgcaggaagtcacc
ctggtgccacagtcctcgcccttcaaggtggtggtgatctcagccatcctggccttggta
gtcctcgtaatcatctctttcttcatcctcattatgctctggcagaagaagccccgctac
gagatccgatggaaggtgattgaatccgtgagctcggatggccatgagtacatctacgtg
gaccctatgcagctgccctatgactccacctgggagcttccacgggaccagcttgtgctt
gggcgcaccctcggttccggggccttcgggcaggtggtggaggccacagctcacggcctg
agccattctcaggccacaatgaaagtggccgtcaagatgctgaaatccactgcccgcagc
agtgagaagcaagcccttatgtcggagctgaagatcatgagtcacctcgggccccacctg
aacgtggtcaacctgcttggagcttgcaccaaaggagggcccatctacatcatcacggag
tactgccgctacggcgacctggtggactacctgcaccgcaacaagcacaccttcctgcag
cactgctccgacaagggccgccgggccagcgccgagctctacagcaacgcgctgcccgtc
gggctccccctgcccagccacatgtccctgcctggggagagtgacggtggctacatggac
atgagcaaggatgagtcggtggactacgtgcccatgctggacatgaaaggggacatcaag
tatgcagacatcgagtcctctaactacatggctccttacgataactacgtcccctccgct
cctgagaggacctgtcgggcgactctgatcaacgaatccccagtgcttagctacacggat
ctcgtgggcttcagctatcaggtggccaatggcatggagttcctggcctccaagaattgt
gtccaccgagacctggcagccaggaacgtgctcatctgtgagggcaaactggtcaagatc
tgtgactttggcctggctcgtgacatcatgcgggattctaactacatctccaaaggcagc
accttcctgcccctgaagtggatggcccccgagagcatcttcaacagcctctacaccacc
ctgagtgacgtttggtccttcgggatcctgctctgggagatcttcaccctgggcggcacc
ccttatccagagctgcccatgaacgagcagttctataacgccatcaagcgaggttaccgc
atggcccagcctgctcatgcctccgacgagatctacgagatcatgcagaagtgctgggag
gagaagtttgagatccggccccctttctcccagctggtgctgcttctcgagagactgctg
ggtgagggttacaaaaagaagtaccagcaggtggatgaggagtttctgaggagcgaccac
ccagctgtcctgcggtcccaagcccgcctgcctggcttccatggcctgcgatctcccctg
cacaccagctcagtcctctacactgccgtgcagcccaacgagggtgacaatgactatatc
atccccctgcctgaccccaaacctgaggctgctgatgagggcccactggagggttccccc
agccttgccagctccaccctgaatgaagtcaacacctcctctaccatctcctgtgacagc
cccctggaaccccaagaggagccagatccagagccccagcccgagccccaggtggaaccg
gagctggagccagggccggagctggagcaggagtggccaccggattcaagctgccctggg
cctcgggccgaggcagaggagagctttctgtag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107498193
Entry
107498193         CDS       T06036                                 

Gene name
EGFR
Definition
(RefSeq) epidermal growth factor receptor
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray01522  Endocrine resistance
ray04010  MAPK signaling pathway
ray04012  ErbB signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04020  Calcium signaling pathway
ray04066  HIF-1 signaling pathway
ray04068  FoxO signaling pathway
ray04072  Phospholipase D signaling pathway
ray04144  Endocytosis
ray04151  PI3K-Akt signaling pathway
ray04510  Focal adhesion
ray04520  Adherens junction
ray04540  Gap junction
ray04630  JAK-STAT signaling pathway
ray04810  Regulation of actin cytoskeleton
ray04912  GnRH signaling pathway
ray04915  Estrogen signaling pathway
ray04921  Oxytocin signaling pathway
ray04926  Relaxin signaling pathway
ray04928  Parathyroid hormone synthesis, secretion and action
ray04934  Cushing syndrome
ray05160  Hepatitis C
ray05163  Human cytomegalovirus infection
ray05165  Human papillomavirus infection
ray05171  Coronavirus disease - COVID-19
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05206  MicroRNAs in cancer
ray05210  Colorectal cancer
ray05212  Pancreatic cancer
ray05213  Endometrial cancer
ray05214  Glioma
ray05215  Prostate cancer
ray05218  Melanoma
ray05219  Bladder cancer
ray05223  Non-small cell lung cancer
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
ray05230  Central carbon metabolism in cancer
ray05231  Choline metabolism in cancer
ray05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107498193 (EGFR)
   04012 ErbB signaling pathway
    107498193 (EGFR)
   04014 Ras signaling pathway
    107498193 (EGFR)
   04015 Rap1 signaling pathway
    107498193 (EGFR)
   04630 JAK-STAT signaling pathway
    107498193 (EGFR)
   04066 HIF-1 signaling pathway
    107498193 (EGFR)
   04068 FoxO signaling pathway
    107498193 (EGFR)
   04020 Calcium signaling pathway
    107498193 (EGFR)
   04072 Phospholipase D signaling pathway
    107498193 (EGFR)
   04151 PI3K-Akt signaling pathway
    107498193 (EGFR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107498193 (EGFR)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107498193 (EGFR)
   04520 Adherens junction
    107498193 (EGFR)
   04540 Gap junction
    107498193 (EGFR)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107498193 (EGFR)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    107498193 (EGFR)
   04915 Estrogen signaling pathway
    107498193 (EGFR)
   04921 Oxytocin signaling pathway
    107498193 (EGFR)
   04926 Relaxin signaling pathway
    107498193 (EGFR)
   04928 Parathyroid hormone synthesis, secretion and action
    107498193 (EGFR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107498193 (EGFR)
   05206 MicroRNAs in cancer
    107498193 (EGFR)
   05205 Proteoglycans in cancer
    107498193 (EGFR)
   05230 Central carbon metabolism in cancer
    107498193 (EGFR)
   05231 Choline metabolism in cancer
    107498193 (EGFR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107498193 (EGFR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107498193 (EGFR)
   05212 Pancreatic cancer
    107498193 (EGFR)
   05225 Hepatocellular carcinoma
    107498193 (EGFR)
   05226 Gastric cancer
    107498193 (EGFR)
   05214 Glioma
    107498193 (EGFR)
   05218 Melanoma
    107498193 (EGFR)
   05219 Bladder cancer
    107498193 (EGFR)
   05215 Prostate cancer
    107498193 (EGFR)
   05213 Endometrial cancer
    107498193 (EGFR)
   05224 Breast cancer
    107498193 (EGFR)
   05223 Non-small cell lung cancer
    107498193 (EGFR)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107498193 (EGFR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    107498193 (EGFR)
   05171 Coronavirus disease - COVID-19
    107498193 (EGFR)
   05163 Human cytomegalovirus infection
    107498193 (EGFR)
   05165 Human papillomavirus infection
    107498193 (EGFR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107498193 (EGFR)
   01522 Endocrine resistance
    107498193 (EGFR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107498193 (EGFR)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107498193 (EGFR)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     107498193 (EGFR)
Protein kinases [BR:ray01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   107498193 (EGFR)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   107498193 (EGFR)
  Exosomal proteins of pancreatic cancer cells
   107498193 (EGFR)
  Exosomal proteins of bladder cancer cells
   107498193 (EGFR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Kinase-like Kdo
Other DBs
NCBI-GeneID: 107498193
NCBI-ProteinID: XP_015976470
LinkDB
Position
Unknown
AA seq 1188 aa
MAATSAGRRRVTGVCQGTNNKLTQLGSFEDHFLSLQRMLNNCEVVLGNLEITYMRRNYDL
SFLKTIQEVAGYVLIALNVAETIPLENLQIIRGNVLFENTHALSVLSNYGENRTGLRELP
MRNLQEILHGAVRFNNNPVLCNVETIQWRDIVDSAFLSNMSMDFQSRMGSCPKCDPSCPN
GSCWGAGQENCQKLTRILCAQQCSRRCRGRSPSDCCHNQCAAGCTGPRESDCLVCHKFRD
EATCKDTCPPLMLYNPTTYEMDVNPEGKYSFGATCVKKCPHNYVVTDHGSCVRACSSDSY
EVEEDGVRKCKKCEGPCRKVCNGIGTGEFKDTLSINATNIKHFKNCTSISGDLHILPVAF
KGDSFTRTPPLDPKELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQF
SLAVVGLHITSLGLRSLKEISDGDVVISGNQKLCYADTIRWQNLFGTVSQKTKIMKNRSA
RDCQAAGHVCHPLCSPEGCWGPEPKDCVSCRNVSRDRECVEKCHLLEGEPREFVENSECV
QCHPECLPQAMNVTCTGRGPDKCVKCAHYVDGPHCVKTCPSGIMGENNTLVWKFSDADHV
CRLCHPNCTYGCMGPGLEGCQERPGISSIATGIVGGLLLLVVLALGVILFLRRRHIVRKR
TLRRLLQERELVEPLTPSGEAPNQALLRVLKETEFKKIKVLGSGAFGTVYKGLWNPEGEK
VKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLVTQLMPFGC
LLDYVREHKDNIGSQCLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFG
LAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDG
IPASEISTVLEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELVLEFCKMARDPQR
YLVIQGDERMDLPSPTDSNFYRALMEEEDMEDVVDADEYLIPQHGFFHSPATSRTPLLSS
LSATSNASTVACIDRNGQSCPLQEDSFLQRYSSDPTGALTEDNINDTFLPAPEYINQSIP
KRPAGSVQNPVYHSQPLSPAAGREPHYQNPHSNAVGNPEYLNTTRPACGDGPVLWVQKGG
HHISLDNPDYQQDFLPKEATSNGTFKGPAAENAEYLRVAPASREFTGA
NT seq 3567 nt   +upstreamnt  +downstreamnt
atggcagcgacttccgcgggccggcgccgcgtcacaggcgtttgccaaggcacaaacaac
aagctcacgcagctgggctcgtttgaggaccacttcctgagcctgcagaggatgctgaac
aactgcgaggtggtccttgggaacctggaaatcacctacatgcgaaggaactacgacctt
tccttcttaaagaccatccaggaggtggccggctacgtcctcatcgccctcaacgtggcg
gagacgatcccgctggaaaacctgcagatcatcaggggcaacgtgctcttcgaaaacacg
cacgccttgtcggtcctgtccaactacggggaaaacagaaccgggctgcgggagctgccc
atgagaaacctgcaggaaatcctgcacggcgccgtgcgcttcaacaacaaccccgtcctc
tgcaacgtggagaccatccagtggcgagacatcgtggacagcgccttcctgagcaacatg
tcgatggactttcagagccggatgggcagctgcccgaagtgtgacccgagctgtcccaac
gggagctgctggggtgcggggcaggagaactgccagaaactgaccaggatcctctgcgcc
cagcagtgctccaggcgctgccgcggccggtcgcccagcgactgctgccacaaccagtgt
gccgccggctgcacgggcccgcgcgagagcgactgcctggtctgccacaagttccgggac
gaagccacgtgcaaggacacctgcccgccgctcatgctgtacaacccgaccacgtacgag
atggacgtcaacccggagggcaaatacagcttcggcgccacctgcgtgaagaagtgcccc
cataactacgtggtgacagaccacggctcgtgcgtccgcgcctgcagctccgacagctac
gaggtggaggaggacggggttcgcaagtgtaagaagtgcgaaggcccctgtcgcaaagtt
tgtaacggaataggaactggtgaatttaaagacacgctttccataaatgccacaaatatc
aaacacttcaaaaactgcacctccatcagtggggaccttcacatcctgccggtcgcgttt
aagggcgactccttcactcgcaccccgcctctggacccgaaggaactggacattctgaaa
accgtaaaggagataacagggtttttgctgattcaggcctggccggaaaacaggactgac
ctccacgctttcgagaacctggaaatcatacgcggcagaacaaagcaacacggccagttt
tcccttgcggtcgtcggcctgcacataacgtcgctgggactgcgctccctcaaggagata
agcgacggagacgtcgtcatctcggggaaccagaagttgtgctacgcggacaccatacgc
tggcaaaacctgtttgggaccgtcagtcagaaaaccaagattatgaagaataggagtgca
cgagactgccaggccgcgggccacgtctgtcacccgctctgctcgccagagggctgctgg
ggcccagagccaaaggactgcgtgtcctgcaggaatgtcagccgtgaccgggagtgcgtg
gagaagtgccacctcctggagggtgagcccagggagttcgtggagaactccgagtgcgtg
cagtgccatccggaatgcctgccccaggccatgaacgtgacctgcacgggacgcggacca
gacaagtgtgtgaagtgtgcgcactacgtcgacggcccgcactgcgtcaagacctgcccg
tccggcatcatgggagaaaacaacacgctggtctggaagttctcggacgccgaccacgtg
tgtcgcctgtgccaccccaactgcacctacggctgcatggggcccggtctggaaggctgc
caggagaggcccgggatctcgtccatcgccaccggcatcgtgggcggcctgctgctgctg
gtggtgctggccctcggggtcatcctgtttctgcgccggcgccacatcgtccgcaagcgc
acgctgcgccggctgctgcaggagagagagctcgtggagcccctcacacccagtggggag
gcccccaaccaggcgctcctgagggtcttgaaggagacggagttcaaaaagatcaaggtg
ctcggctccggcgcattcggcacggtgtacaagggactctggaacccggaaggcgagaag
gtcaaaatccccgtggctatcaaggaattaagagaggccacgtctccgaaagccaacaag
gagattctcgatgaggcgtacgtgatggccagcgtggacaacccgcacgtgtgccggctg
ctgggcatctgcctgacctccacggtgcagctggtcacgcagctcatgcccttcggctgc
ctgctggactacgtccgcgagcacaaggacaacatcggctcccagtgcctgctcaactgg
tgtgtgcagatcgccaagggcatgaactacctggaggaccggcgtctggtgcatcgcgac
ctggccgccaggaacgtcctggtgaagacgccgcagcacgtcaagatcacagactttggg
ctggccaagctgctgggcgccgaggagaaggagtaccacgcggagggaggcaaggtgcct
atcaagtggatggctttggaatcgattttacaccgaatctacacccaccaaagtgacgtc
tggagctacggcgtcactgtttgggagctgatgacgttcgggtccaagccctatgacgga
atcccggcgagcgagatctcgaccgtgctggagaagggagagcgcctcccgcagccgccc
atatgcaccatcgacgtctacatgatcatggtcaagtgctggatgatagatgcagacagt
cgcccaaagttccgtgagttggtcctcgaattctgcaaaatggcccgagacccccagcgc
taccttgtcatccagggcgacgagcggatggacttgcccagccccacggactcgaacttc
taccgcgccctcatggaagaggaggacatggaggacgtggtggacgcggacgagtacctg
atcccgcagcacggcttcttccacagcccagccacgtcccgcacgccgctcctcagctcc
ctgagcgccaccagcaacgcctccaccgtggcgtgcatcgacagaaacgggcagagctgt
cccctccaggaagacagcttcttacagcgctacagctcagaccccaccggcgccttgacc
gaggacaacatcaacgacactttcctgccggcgcccgaatacataaaccagtccatcccc
aaaaggcccgcgggctcggtgcagaacccggtgtaccacagtcagcccctgagtcccgcc
gcgggcagagagccgcactaccagaacccccacagcaacgccgtgggcaaccccgagtat
ctcaacaccacccgccccgcctgcggcgacggccctgtcctctgggtgcagaagggcggc
caccacatcagcctggacaaccctgactaccagcaggacttcctgcccaaggaagccacg
tcgaacggcacgttcaagggccctgccgccgagaacgcagagtacttgcgggtagcccca
gcgagccgcgagttcactggcgcgtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107499793
Entry
107499793         CDS       T06036                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha isoform X1
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04020  Calcium signaling pathway
ray04072  Phospholipase D signaling pathway
ray04144  Endocytosis
ray04151  PI3K-Akt signaling pathway
ray04510  Focal adhesion
ray04540  Gap junction
ray04630  JAK-STAT signaling pathway
ray04810  Regulation of actin cytoskeleton
ray05163  Human cytomegalovirus infection
ray05200  Pathways in cancer
ray05206  MicroRNAs in cancer
ray05214  Glioma
ray05215  Prostate cancer
ray05218  Melanoma
ray05230  Central carbon metabolism in cancer
ray05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107499793 (PDGFRA)
   04014 Ras signaling pathway
    107499793 (PDGFRA)
   04015 Rap1 signaling pathway
    107499793 (PDGFRA)
   04630 JAK-STAT signaling pathway
    107499793 (PDGFRA)
   04020 Calcium signaling pathway
    107499793 (PDGFRA)
   04072 Phospholipase D signaling pathway
    107499793 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    107499793 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107499793 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107499793 (PDGFRA)
   04540 Gap junction
    107499793 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107499793 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107499793 (PDGFRA)
   05206 MicroRNAs in cancer
    107499793 (PDGFRA)
   05230 Central carbon metabolism in cancer
    107499793 (PDGFRA)
   05231 Choline metabolism in cancer
    107499793 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    107499793 (PDGFRA)
   05218 Melanoma
    107499793 (PDGFRA)
   05215 Prostate cancer
    107499793 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    107499793 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107499793 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107499793 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ray04090]
    107499793 (PDGFRA)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     107499793 (PDGFRA)
Protein kinases [BR:ray01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   107499793 (PDGFRA)
CD molecules [BR:ray04090]
 Proteins
  107499793 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 Herpes_gE C2-set_2 Kinase-like
Other DBs
NCBI-GeneID: 107499793
NCBI-ProteinID: XP_015979779
LinkDB
Position
Unknown
AA seq 1138 aa
MWVWRSRRQEGVSADSPGRRWANRGPGRAVGDPEPELRTRERASQPFSRAMGTSHPAFLV
LGCLLAGPSLILCQLSLPSILPNENEKVVQLNSSFSLRCFGESEVSWQYPLSDENSNVEI
RNEENNSGLFVAVLEVVNASAAHTGLYTCYYNHTQTEENEIEGRRIYIYVPDPDVAFVPL
GMTDYLVIVEDDDSAIIPCRTTDPDTPVTLLNSDGVVLASYNSRQGFNGTFTVGLYICEA
TVRGRKFRTIPFNVYALKATSELDLEMEAPKTVYKSGETVVVTCAVFNNEVVDLQWTYPG
EMRGKGVTTLEETKVPFIKLVYTLKVPGATVKDSGEYGCAARQATKEVKEMKKVTISVHE
KGFIEIKPNFSQLEAVNLHEVKHFVVDVQAYPPPRISWLKDNLTLIENLTEITTDIEKIQ
EIRYRSKLKLIRAKEEDSGHYTIIVQNEDDVKSYTFELLTQVPSSILDLVDDHHGATGGQ
TVRCTAVGTPLPDIEWMICKDIKKCNNETSWTILANNISNIVTEVHLRDRSTVEGRVTFA
KVEETIAVRCLARNLLGAENRELKLVAPTLRSELTVAAAVLVLLVIVIISLIVLVVIWKQ
KPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILGSGAFGKVVEGT
AYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNLLGACTKSGPIY
IITEYCFYGDLVNYLHKNRDSFLSRHPEKPKKELDIFGLNPADESTRSYVILSFENNGDY
MDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKSMLDSEVKNLLSDDNSEGLT
LLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLARDIMHDSNYVS
KGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMMVDSTFYNKIKS
GYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKKSYEKIHLDFLK
SDHPAVARMRVDADNAYIGVTYKNEEDKLKDWEGGLDEQRLSADSGYIIPLPDIDPVPEE
EDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDSSDLVEDSFL
NT seq 3417 nt   +upstreamnt  +downstreamnt
atgtgggtgtggcggagcaggaggcaggaaggtgtcagcgcagactctcctgggagaagg
tgggcgaaccgcggtcccggccgcgctgtcggggacccggagcccgagctgcggacgcga
gagcgagccagccagccgttttccagagctatggggacttcccatcctgcattcctggtc
ttaggctgtctccttgcagggccgagcctaatcctctgccagctttcattaccctctatc
ctcccaaacgaaaatgaaaaggttgtgcagctgaattcatccttttctctgagatgcttt
ggggagagcgaagtgagctggcagtaccccttgtctgacgagaactccaacgtggaaatc
agaaatgaggagaataacagtggcctttttgtggccgtgctggaagtggtcaatgcctcg
gcagcccacacggggctgtacacttgctattacaaccacacgcagacagaagaaaatgag
atcgaaggccgacgcatttacatctacgtgccagacccggatgtagcctttgtacctctg
ggaatgacagattatttagtcatcgtggaagacgatgactctgccatcataccttgtcga
acaaccgaccccgatactccagtaaccttactcaacagtgatggggtggtcctcgcctcc
tataacagcagacagggctttaatggaaccttcaccgttgggctctatatctgcgaggcc
accgtcagagggaggaagttccggaccattccatttaatgtttatgctttaaaagcaaca
tcagaacttgatctagaaatggaagcccctaaaactgtatataagtcaggagaaacggtt
gtggtcacctgtgccgtctttaacaacgaggtggttgaccttcagtggacttatcccgga
gaaatgaggggcaaaggtgtcacgacgctggaggaaaccaaggtccccttcatcaagctg
gtgtacacgctgaaggtccctggggccacggtgaaagacagtggagagtatggatgtgcc
gcccgccaggccaccaaggaggtcaaagagatgaagaaagtcaccatttctgtccatgag
aaagggttcattgaaatcaaacccaacttcagccagttggaagctgtcaacctgcatgaa
gtaaaacatttcgtggtggatgtgcaggcctaccctcctcccaggatatcctggctgaaa
gataacctgactctgatcgaaaacctcaccgagatcaccactgacatagaaaagattcag
gaaataaggtatcgaagcaaattaaagctgattcgtgctaaggaagaagacagtggccat
tatactattatagttcaaaatgaagatgatgtgaagagctatacttttgaactcttaact
caagttccctcatctattctggacttggtcgatgatcaccatggtgctacagggggacag
actgtgagatgcacagccgtagggacacctcttcctgatattgaatggatgatttgcaag
gatattaagaaatgtaacaatgagacttcatggacgattttggccaacaacatctcaaac
attgtcacagaggtccacctccgggacaggagcacagtggagggccgggtgacattcgcc
aaagtggaggagactattgcagttcgatgtctggctaggaatcttcttggggctgagaac
cgagagctgaagctggtggctcccactctgcgttctgaacttacagtggcggccgcagtc
ctggtgctcttggtgattgtgatcatctcactgattgtcctggttgtcatttggaaacag
aaaccgaggtatgaaattcgctggagggtcattgaatcaatcagccccgatggacatgaa
tatatttatgtggacccgatgcagctgccttatgactcgagatgggagtttccaagagat
ggactagtgctgggtcgtatcctgggatctggtgcgtttgggaaagtggttgaaggaacc
gcctatggattaagcaggtcccagcctgtcatgaaggtggcagtaaagatgcttaaaccc
acagccagatccagcgaaaaacaagctctcatgtctgaactgaagataatgactcacctg
gggccacatttaaacattgtaaacttgctgggagcctgtaccaagtcgggccccatttac
atcatcactgagtactgtttctatggggatttggtcaactatttgcataagaatagggac
agcttcctgagccgccacccagagaagccaaagaaagagctggacatcttcggattgaac
cccgctgatgaaagcactcggagttatgttattttatcttttgaaaacaatggtgactac
atggacatgaagcaagccgataccacacagtatgtccccatgctggaaaggaaagaggtt
tctaaatattcagacatccagagatctctgtatgatcgcccagcctcatataagaagaaa
tctatgttagattcggaagtcaaaaaccttctttcagacgataactcggaaggccttact
ttgttggatttgttgagctttacctatcaggttgcccgaggaatggaatttttggcttcg
aaaaattgtgtccaccgggacctggccgctcgcaacgtcctcctggcacaagggaaaatt
gtgaagatctgtgactttggcctggccagagatattatgcatgattccaactacgtgtcg
aaaggcagcaccttcctccctgtgaagtggatggctcctgagagcatcttcgacaacctc
tacaccacactgagtgacgtctggtcttacggcattcttctgtgggagatcttttccctt
ggtggtacaccctacccgggcatgatggtggattctactttctacaacaagatcaagagt
gggtaccggatggccaagcctgaccacgccaccagtgaagtctatgagatcatggtgaag
tgctggaacagtgagccggagaagagaccttccttttaccacctgagtgaaattgtggag
aacctgttgcctggacaatataaaaagagttatgaaaagattcacctggacttcctgaag
agtgaccatcccgcagtggcacgcatgcgcgtggatgctgacaatgcttatattggtgtc
acctataaaaatgaagaggacaagctgaaggactgggagggcggccttgatgagcagagg
ctgagtgcagacagcggctatatcatccctctgccggacatcgaccccgtgcctgaggaa
gaagacctgggcaagagaaacagacacagctcacagacctctgaagagagtgctattgag
acgggttccagcagttctaccttcatcaagagagaggatgagaccattgaagacatcgac
atgatggatgacattggtatagactcctcagacctggtggaggacagcttcctgtaa

DBGET integrated database retrieval system