KEGG   Rousettus aegyptiacus (Egyptian rousette): 107497163
Entry
107497163         CDS       T06036                                 

Gene name
PDGFRB
Definition
(RefSeq) platelet-derived growth factor receptor beta
  KO
K05089  platelet-derived growth factor receptor beta [EC:2.7.10.1]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04020  Calcium signaling pathway
ray04072  Phospholipase D signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04510  Focal adhesion
ray04540  Gap junction
ray04630  JAK-STAT signaling pathway
ray04810  Regulation of actin cytoskeleton
ray05165  Human papillomavirus infection
ray05200  Pathways in cancer
ray05206  MicroRNAs in cancer
ray05214  Glioma
ray05215  Prostate cancer
ray05218  Melanoma
ray05230  Central carbon metabolism in cancer
ray05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107497163 (PDGFRB)
   04014 Ras signaling pathway
    107497163 (PDGFRB)
   04015 Rap1 signaling pathway
    107497163 (PDGFRB)
   04630 JAK-STAT signaling pathway
    107497163 (PDGFRB)
   04020 Calcium signaling pathway
    107497163 (PDGFRB)
   04072 Phospholipase D signaling pathway
    107497163 (PDGFRB)
   04151 PI3K-Akt signaling pathway
    107497163 (PDGFRB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107497163 (PDGFRB)
   04540 Gap junction
    107497163 (PDGFRB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107497163 (PDGFRB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107497163 (PDGFRB)
   05206 MicroRNAs in cancer
    107497163 (PDGFRB)
   05230 Central carbon metabolism in cancer
    107497163 (PDGFRB)
   05231 Choline metabolism in cancer
    107497163 (PDGFRB)
  09162 Cancer: specific types
   05214 Glioma
    107497163 (PDGFRB)
   05218 Melanoma
    107497163 (PDGFRB)
   05215 Prostate cancer
    107497163 (PDGFRB)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107497163 (PDGFRB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107497163 (PDGFRB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107497163 (PDGFRB)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ray04090]
    107497163 (PDGFRB)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     107497163 (PDGFRB)
Protein kinases [BR:ray01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   107497163 (PDGFRB)
CD molecules [BR:ray04090]
 Proteins
  107497163 (PDGFRB)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 ig I-set Ig_2 V-set Ig_6
Other DBs
NCBI-GeneID: 107497163
NCBI-ProteinID: XP_015974233
LinkDB
Position
Unknown
AA seq 1110 aa
MLLLSAVPAPVPKGQVLLLPLLVLLGPQVSQGLVITPSEPEIVLNVSSTFVLTCSGPAPV
MWKRMMPKQLPQELTETPDGNFSSVLTLTNVNGSDTGEYFCTYNDSHGLEDGEQKRLYIF
VPDPNMGFLPVYPEEVFIFLTEVTEITIPCRVTDPQLVVTLHEKKVDVPLPFPYDHQRGF
SGTFEDKTYVCKTIIGDKEVDSEAYYVYSLQASSINISMNAVQTVVRQGENITITCIVTG
NEVVNFEWMYPRKESGRLVEPVTDFDTPSHIRSILHIPSVELGDSGTYICNVSESVYDHG
DEKAINVTVVESGYVHLLEELDAVQFAELHRSRTLQVVFEAYPPPTVMWLKDNRTLGDSS
AGEIALSTRNVSETRYVSELTLVRVKVAEAGHYTMRAFHEDAEAQLSFQLQINVPARVLE
LSESHPANGEQTVRCRGRGMPRPHLTWSTCGDLKRCPRELPPTPLGNSSEESQLETNVTY
WAEEQEFEVVSMLRLSHVDQPLSVRCTLRNLLGHDVQEVTLVPQSSPFKVVVISAILALV
VLVIISFFILIMLWQKKPRYEIRWKVIESVSSDGHEYIYVDPMQLPYDSTWELPRDQLVL
GRTLGSGAFGQVVEATAHGLSHSQATMKVAVKMLKSTARSSEKQALMSELKIMSHLGPHL
NVVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTFLQHCSDKGRRASAELYSNALPV
GLPLPSHMSLPGESDGGYMDMSKDESVDYVPMLDMKGDIKYADIESSNYMAPYDNYVPSA
PERTCRATLINESPVLSYTDLVGFSYQVANGMEFLASKNCVHRDLAARNVLICEGKLVKI
CDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWEIFTLGGT
PYPELPMNEQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFEIRPPFSQLVLLLERLL
GEGYKKKYQQVDEEFLRSDHPAVLRSQARLPGFHGLRSPLHTSSVLYTAVQPNEGDNDYI
IPLPDPKPEAADEGPLEGSPSLASSTLNEVNTSSTISCDSPLEPQEEPDPEPQPEPQVEP
ELEPGPELEQEWPPDSSCPGPRAEAEESFL
NT seq 3333 nt   +upstreamnt  +downstreamnt
atgctgcttctgagtgccgtgccagctcctgtccccaaaggccaggtgctgttgctgccc
ctgctggtgttgctgggaccgcaggtctcccaaggtctggtcatcacaccctcagagcca
gagattgtcctcaatgtctccagcaccttcgttctgacttgctcgggtccagctccggtg
atgtggaaacggatgatgcccaagcagctcccgcaagaactgactgagaccccggatggc
aacttctccagcgtactgacgctgaccaatgtcaatgggtcggacacaggggaatacttt
tgtacctacaatgactcccatgggctggaggatggtgagcaaaaacggctctatatcttc
gtgccagatcccaacatgggctttcttcctgtgtaccctgaggaagtattcatctttctc
acggaagtaactgagatcacgattccatgccgagtgacggatccacaactggtggtgacg
ctgcatgagaagaaggtggatgtccccctgcctttcccctacgaccaccaacgtggcttc
tctgggacctttgaagacaagacctatgtctgcaaaaccatcatcggggacaaagaggtg
gattccgaagcctactacgtctacagcctccaggcatcatccatcaacatctcaatgaat
gcagtgcagaccgtggtccgccagggtgagaacatcactatcacatgcatcgtgactggg
aacgaggtggtcaactttgagtggatgtacccccgcaaggagagtgggcggctggtggag
ccagtgaccgactttgatacgccctcccacatacgctccatcctgcacatccccagtgtc
gagctgggtgactcgggcacctatatctgcaatgtatcagagagtgtgtacgaccacgga
gatgaaaaggccatcaatgtcaccgtggttgagagtggctacgtgcacttgctggaggag
ctggatgctgtacaattcgcagagctgcaccggagccgaacactgcaggtggtgttcgaa
gcctacccgccacccactgtcatgtggctcaaggacaaccgcaccctgggcgactccagc
gctggcgagatcgccctgtctacgcgcaatgtgtcggagactcggtacgtgtcagaactg
acattggtgcgggtgaaggtggctgaggctggtcactacaccatgagggccttccatgag
gacgctgaggcccaactctccttccagctgcaaattaacgtgcctgcccgtgtgctggag
ctgagcgagagccaccctgccaacggggagcagacagtccgctgtcgcggccggggcatg
ccccggccacacctcacctggtctacctgcggtgacctcaaaaggtgtccgcgcgagctg
ccacccacgccactggggaacagttccgaggagagccagctggagacaaacgtaacgtac
tgggcggaggagcaggagtttgaggtggtgagcatgctgcgcctgagccatgtggatcag
ccgctgtctgtgcgctgcacgctgcgcaacctgctgggccatgacgtgcaggaagtcacc
ctggtgccacagtcctcgcccttcaaggtggtggtgatctcagccatcctggccttggta
gtcctcgtaatcatctctttcttcatcctcattatgctctggcagaagaagccccgctac
gagatccgatggaaggtgattgaatccgtgagctcggatggccatgagtacatctacgtg
gaccctatgcagctgccctatgactccacctgggagcttccacgggaccagcttgtgctt
gggcgcaccctcggttccggggccttcgggcaggtggtggaggccacagctcacggcctg
agccattctcaggccacaatgaaagtggccgtcaagatgctgaaatccactgcccgcagc
agtgagaagcaagcccttatgtcggagctgaagatcatgagtcacctcgggccccacctg
aacgtggtcaacctgcttggagcttgcaccaaaggagggcccatctacatcatcacggag
tactgccgctacggcgacctggtggactacctgcaccgcaacaagcacaccttcctgcag
cactgctccgacaagggccgccgggccagcgccgagctctacagcaacgcgctgcccgtc
gggctccccctgcccagccacatgtccctgcctggggagagtgacggtggctacatggac
atgagcaaggatgagtcggtggactacgtgcccatgctggacatgaaaggggacatcaag
tatgcagacatcgagtcctctaactacatggctccttacgataactacgtcccctccgct
cctgagaggacctgtcgggcgactctgatcaacgaatccccagtgcttagctacacggat
ctcgtgggcttcagctatcaggtggccaatggcatggagttcctggcctccaagaattgt
gtccaccgagacctggcagccaggaacgtgctcatctgtgagggcaaactggtcaagatc
tgtgactttggcctggctcgtgacatcatgcgggattctaactacatctccaaaggcagc
accttcctgcccctgaagtggatggcccccgagagcatcttcaacagcctctacaccacc
ctgagtgacgtttggtccttcgggatcctgctctgggagatcttcaccctgggcggcacc
ccttatccagagctgcccatgaacgagcagttctataacgccatcaagcgaggttaccgc
atggcccagcctgctcatgcctccgacgagatctacgagatcatgcagaagtgctgggag
gagaagtttgagatccggccccctttctcccagctggtgctgcttctcgagagactgctg
ggtgagggttacaaaaagaagtaccagcaggtggatgaggagtttctgaggagcgaccac
ccagctgtcctgcggtcccaagcccgcctgcctggcttccatggcctgcgatctcccctg
cacaccagctcagtcctctacactgccgtgcagcccaacgagggtgacaatgactatatc
atccccctgcctgaccccaaacctgaggctgctgatgagggcccactggagggttccccc
agccttgccagctccaccctgaatgaagtcaacacctcctctaccatctcctgtgacagc
cccctggaaccccaagaggagccagatccagagccccagcccgagccccaggtggaaccg
gagctggagccagggccggagctggagcaggagtggccaccggattcaagctgccctggg
cctcgggccgaggcagaggagagctttctgtag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107499793
Entry
107499793         CDS       T06036                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha isoform X1
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04020  Calcium signaling pathway
ray04072  Phospholipase D signaling pathway
ray04144  Endocytosis
ray04151  PI3K-Akt signaling pathway
ray04510  Focal adhesion
ray04540  Gap junction
ray04630  JAK-STAT signaling pathway
ray04810  Regulation of actin cytoskeleton
ray05163  Human cytomegalovirus infection
ray05200  Pathways in cancer
ray05206  MicroRNAs in cancer
ray05214  Glioma
ray05215  Prostate cancer
ray05218  Melanoma
ray05230  Central carbon metabolism in cancer
ray05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107499793 (PDGFRA)
   04014 Ras signaling pathway
    107499793 (PDGFRA)
   04015 Rap1 signaling pathway
    107499793 (PDGFRA)
   04630 JAK-STAT signaling pathway
    107499793 (PDGFRA)
   04020 Calcium signaling pathway
    107499793 (PDGFRA)
   04072 Phospholipase D signaling pathway
    107499793 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    107499793 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107499793 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107499793 (PDGFRA)
   04540 Gap junction
    107499793 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107499793 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107499793 (PDGFRA)
   05206 MicroRNAs in cancer
    107499793 (PDGFRA)
   05230 Central carbon metabolism in cancer
    107499793 (PDGFRA)
   05231 Choline metabolism in cancer
    107499793 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    107499793 (PDGFRA)
   05218 Melanoma
    107499793 (PDGFRA)
   05215 Prostate cancer
    107499793 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    107499793 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107499793 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107499793 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ray04090]
    107499793 (PDGFRA)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     107499793 (PDGFRA)
Protein kinases [BR:ray01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   107499793 (PDGFRA)
CD molecules [BR:ray04090]
 Proteins
  107499793 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 Herpes_gE C2-set_2 Kinase-like
Other DBs
NCBI-GeneID: 107499793
NCBI-ProteinID: XP_015979779
LinkDB
Position
Unknown
AA seq 1138 aa
MWVWRSRRQEGVSADSPGRRWANRGPGRAVGDPEPELRTRERASQPFSRAMGTSHPAFLV
LGCLLAGPSLILCQLSLPSILPNENEKVVQLNSSFSLRCFGESEVSWQYPLSDENSNVEI
RNEENNSGLFVAVLEVVNASAAHTGLYTCYYNHTQTEENEIEGRRIYIYVPDPDVAFVPL
GMTDYLVIVEDDDSAIIPCRTTDPDTPVTLLNSDGVVLASYNSRQGFNGTFTVGLYICEA
TVRGRKFRTIPFNVYALKATSELDLEMEAPKTVYKSGETVVVTCAVFNNEVVDLQWTYPG
EMRGKGVTTLEETKVPFIKLVYTLKVPGATVKDSGEYGCAARQATKEVKEMKKVTISVHE
KGFIEIKPNFSQLEAVNLHEVKHFVVDVQAYPPPRISWLKDNLTLIENLTEITTDIEKIQ
EIRYRSKLKLIRAKEEDSGHYTIIVQNEDDVKSYTFELLTQVPSSILDLVDDHHGATGGQ
TVRCTAVGTPLPDIEWMICKDIKKCNNETSWTILANNISNIVTEVHLRDRSTVEGRVTFA
KVEETIAVRCLARNLLGAENRELKLVAPTLRSELTVAAAVLVLLVIVIISLIVLVVIWKQ
KPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILGSGAFGKVVEGT
AYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNLLGACTKSGPIY
IITEYCFYGDLVNYLHKNRDSFLSRHPEKPKKELDIFGLNPADESTRSYVILSFENNGDY
MDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKSMLDSEVKNLLSDDNSEGLT
LLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLARDIMHDSNYVS
KGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMMVDSTFYNKIKS
GYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKKSYEKIHLDFLK
SDHPAVARMRVDADNAYIGVTYKNEEDKLKDWEGGLDEQRLSADSGYIIPLPDIDPVPEE
EDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDSSDLVEDSFL
NT seq 3417 nt   +upstreamnt  +downstreamnt
atgtgggtgtggcggagcaggaggcaggaaggtgtcagcgcagactctcctgggagaagg
tgggcgaaccgcggtcccggccgcgctgtcggggacccggagcccgagctgcggacgcga
gagcgagccagccagccgttttccagagctatggggacttcccatcctgcattcctggtc
ttaggctgtctccttgcagggccgagcctaatcctctgccagctttcattaccctctatc
ctcccaaacgaaaatgaaaaggttgtgcagctgaattcatccttttctctgagatgcttt
ggggagagcgaagtgagctggcagtaccccttgtctgacgagaactccaacgtggaaatc
agaaatgaggagaataacagtggcctttttgtggccgtgctggaagtggtcaatgcctcg
gcagcccacacggggctgtacacttgctattacaaccacacgcagacagaagaaaatgag
atcgaaggccgacgcatttacatctacgtgccagacccggatgtagcctttgtacctctg
ggaatgacagattatttagtcatcgtggaagacgatgactctgccatcataccttgtcga
acaaccgaccccgatactccagtaaccttactcaacagtgatggggtggtcctcgcctcc
tataacagcagacagggctttaatggaaccttcaccgttgggctctatatctgcgaggcc
accgtcagagggaggaagttccggaccattccatttaatgtttatgctttaaaagcaaca
tcagaacttgatctagaaatggaagcccctaaaactgtatataagtcaggagaaacggtt
gtggtcacctgtgccgtctttaacaacgaggtggttgaccttcagtggacttatcccgga
gaaatgaggggcaaaggtgtcacgacgctggaggaaaccaaggtccccttcatcaagctg
gtgtacacgctgaaggtccctggggccacggtgaaagacagtggagagtatggatgtgcc
gcccgccaggccaccaaggaggtcaaagagatgaagaaagtcaccatttctgtccatgag
aaagggttcattgaaatcaaacccaacttcagccagttggaagctgtcaacctgcatgaa
gtaaaacatttcgtggtggatgtgcaggcctaccctcctcccaggatatcctggctgaaa
gataacctgactctgatcgaaaacctcaccgagatcaccactgacatagaaaagattcag
gaaataaggtatcgaagcaaattaaagctgattcgtgctaaggaagaagacagtggccat
tatactattatagttcaaaatgaagatgatgtgaagagctatacttttgaactcttaact
caagttccctcatctattctggacttggtcgatgatcaccatggtgctacagggggacag
actgtgagatgcacagccgtagggacacctcttcctgatattgaatggatgatttgcaag
gatattaagaaatgtaacaatgagacttcatggacgattttggccaacaacatctcaaac
attgtcacagaggtccacctccgggacaggagcacagtggagggccgggtgacattcgcc
aaagtggaggagactattgcagttcgatgtctggctaggaatcttcttggggctgagaac
cgagagctgaagctggtggctcccactctgcgttctgaacttacagtggcggccgcagtc
ctggtgctcttggtgattgtgatcatctcactgattgtcctggttgtcatttggaaacag
aaaccgaggtatgaaattcgctggagggtcattgaatcaatcagccccgatggacatgaa
tatatttatgtggacccgatgcagctgccttatgactcgagatgggagtttccaagagat
ggactagtgctgggtcgtatcctgggatctggtgcgtttgggaaagtggttgaaggaacc
gcctatggattaagcaggtcccagcctgtcatgaaggtggcagtaaagatgcttaaaccc
acagccagatccagcgaaaaacaagctctcatgtctgaactgaagataatgactcacctg
gggccacatttaaacattgtaaacttgctgggagcctgtaccaagtcgggccccatttac
atcatcactgagtactgtttctatggggatttggtcaactatttgcataagaatagggac
agcttcctgagccgccacccagagaagccaaagaaagagctggacatcttcggattgaac
cccgctgatgaaagcactcggagttatgttattttatcttttgaaaacaatggtgactac
atggacatgaagcaagccgataccacacagtatgtccccatgctggaaaggaaagaggtt
tctaaatattcagacatccagagatctctgtatgatcgcccagcctcatataagaagaaa
tctatgttagattcggaagtcaaaaaccttctttcagacgataactcggaaggccttact
ttgttggatttgttgagctttacctatcaggttgcccgaggaatggaatttttggcttcg
aaaaattgtgtccaccgggacctggccgctcgcaacgtcctcctggcacaagggaaaatt
gtgaagatctgtgactttggcctggccagagatattatgcatgattccaactacgtgtcg
aaaggcagcaccttcctccctgtgaagtggatggctcctgagagcatcttcgacaacctc
tacaccacactgagtgacgtctggtcttacggcattcttctgtgggagatcttttccctt
ggtggtacaccctacccgggcatgatggtggattctactttctacaacaagatcaagagt
gggtaccggatggccaagcctgaccacgccaccagtgaagtctatgagatcatggtgaag
tgctggaacagtgagccggagaagagaccttccttttaccacctgagtgaaattgtggag
aacctgttgcctggacaatataaaaagagttatgaaaagattcacctggacttcctgaag
agtgaccatcccgcagtggcacgcatgcgcgtggatgctgacaatgcttatattggtgtc
acctataaaaatgaagaggacaagctgaaggactgggagggcggccttgatgagcagagg
ctgagtgcagacagcggctatatcatccctctgccggacatcgaccccgtgcctgaggaa
gaagacctgggcaagagaaacagacacagctcacagacctctgaagagagtgctattgag
acgggttccagcagttctaccttcatcaagagagaggatgagaccattgaagacatcgac
atgatggatgacattggtatagactcctcagacctggtggaggacagcttcctgtaa

DBGET integrated database retrieval system