KEGG   Rousettus aegyptiacus (Egyptian rousette): 107497166
Entry
107497166         CDS       T06036                                 

Gene name
DCTN4
Definition
(RefSeq) dynactin subunit 4 isoform X1
  KO
K10426  dynactin 4
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04962  Vasopressin-regulated water reabsorption
ray05014  Amyotrophic lateral sclerosis
ray05016  Huntington disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107497166 (DCTN4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    107497166 (DCTN4)
   05016 Huntington disease
    107497166 (DCTN4)
   05022 Pathways of neurodegeneration - multiple diseases
    107497166 (DCTN4)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107497166 (DCTN4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ray03036]
    107497166 (DCTN4)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107497166 (DCTN4)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Dynactin complex
     107497166 (DCTN4)
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dynactins
     107497166 (DCTN4)
SSDB
Motif
Pfam: Dynactin_p62
Other DBs
NCBI-GeneID: 107497166
NCBI-ProteinID: XP_015974240
LinkDB
Position
Unknown
AA seq 467 aa
MASLLQSERVLYLVQGEKKVRAPLSQLYFCRYCSELRSLECVSHEVDSHYCPSCLENMPS
AEAKLKKNRCANCFDCPGCMHTLSTRATSISTQLPDDPAKTTMKKAYYLACGFCRWTSRD
VGMADKSVASGGWQEPENPHTQRMNKLIEYYQQLAQKEKVERDRKKLARRRNYMPLAFSQ
HTIHVVDKYGLGTRLQRPRAGATISTLAGLSLKEGEDQKEIKIEPAQAVDEVEPLPEDYY
TRPVNLTEVTTLQQRLLQPDFQPICASQLYPRHKHLLIKRSLRCRKCEHNLSKPEFNPTS
IKFKIQLVAVNYIPEVRIMSIPNLRYMKESQVLLTLTNPVENLTHVTLLECDEGDPDNIN
STAKVAVPPKELILAGKDAAAEYDELAEPQDFQDDPDVIAFRKANKVGIFIKVTPQREEG
EVTVCFKMKHDFKNLAAPIRPIEEGDQGSEVIWLTQHVELSLGPLLP
NT seq 1404 nt   +upstreamnt  +downstreamnt
atggcgtctctgctgcaatcggagcgggttctctacctagtccagggagaaaagaaggtt
cgggccccgctctcgcagctttacttctgccgctattgtagcgagttgcggtcgctggaa
tgtgtgtctcacgaggtggactcccattattgtcccagttgcttagaaaatatgccatca
gctgaagccaaactaaaaaagaacagatgtgccaactgcttcgactgtcctggctgcatg
cacaccctctccactcgggctacaagcatctccacgcagcttccagatgacccagccaag
actaccatgaagaaagcctattatctggcttgtggattttgtcgctggacatctcgagat
gtgggcatggcagacaaatctgtggccagtggtggttggcaagaacctgaaaatcctcac
actcaacggatgaacaaactgattgaatattaccagcagcttgctcagaaagagaaagtt
gagcgagatcgcaagaaactggcgcggcgtagaaactatatgcctttggccttctcgcaa
cacactattcatgtagtggacaaatatggtcttggaaccaggcttcagcgaccacgagct
ggtgcaaccatcagtacccttgctggactttcccttaaagaaggagaggaccagaaagag
ataaagattgagccagctcaagctgtagatgaagtggaacctctacccgaagactactat
acaagaccagtaaatttaacagaggtgaccacccttcagcagcgcctcttacagcctgac
ttccaaccaatctgtgcatcccagctctatcctcgtcacaaacatcttctgatcaaacgg
tccctgcgctgccggaaatgtgaacataatttgagcaagccagagtttaatccaacatct
atcaaattcaaaatccaactggttgctgtcaattatatcccagaagtgagaatcatgtca
attcccaaccttcgctacatgaaggagagccaggtcctcctgactctcacgaacccagtg
gagaacctcacccacgtgaccctgttggagtgcgatgagggagaccctgataatatcaat
agcactgctaaggtggcggttcctcccaaagagctcattttagctggcaaagacgcagca
gcagagtatgatgagttggcagaaccccaggactttcaggatgatcctgacgttatagcc
ttcagaaaggccaacaaagtgggtattttcatcaaagtgacgccacaacgtgaggagggc
gaagtgaccgtgtgctttaagatgaagcatgattttaaaaacctggcagcccccatccgc
cccatcgaagaaggtgaccagggctcagaagtcatctggctcacccagcatgtggaactg
agcttgggcccgcttcttccttaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107501501
Entry
107501501         CDS       T06036                                 

Gene name
DCTN2
Definition
(RefSeq) dynactin subunit 2 isoform X1
  KO
K10424  dynactin 2
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04962  Vasopressin-regulated water reabsorption
ray05014  Amyotrophic lateral sclerosis
ray05016  Huntington disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107501501 (DCTN2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    107501501 (DCTN2)
   05016 Huntington disease
    107501501 (DCTN2)
   05022 Pathways of neurodegeneration - multiple diseases
    107501501 (DCTN2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107501501 (DCTN2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ray03036]
    107501501 (DCTN2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107501501 (DCTN2)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Dynactin complex
     107501501 (DCTN2)
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dynactins
     107501501 (DCTN2)
SSDB
Motif
Pfam: Dynamitin ZapB TIR-like PRD
Other DBs
NCBI-GeneID: 107501501
NCBI-ProteinID: XP_015983196
LinkDB
Position
Unknown
AA seq 408 aa
MADPKYADLPGIARNEPDVYETSDLPEDDQAEFDAFAQELEELTSTSVEHIIVNPNAAYD
KFKDKRVGTKGLDFSDRIGKTKRTGYESGEYEMLGEGLGVKETPQQKYQRLLHEVQELTS
EVEKIKTAVKESATEEKLTPVVLAKQLAALKQQLLASHLEKLLGPDAAINLTDPDGALAK
RLLLQLEATKNSKGAGSGGKTTSGTFPDGSLVTYELHSRPEQDKFSQTAKVAELERRLTE
LEATVRCDQDAQNPLSAGLQGACLTETVELLQAKVSALDLAVLDQVEARLQSVLGKMNEI
AKHKASVEDADTQSKVHQLYETIQRWSPIASTLPELVQRLVTIKQLHEQAMQFSQLLTHL
DTTQQMITSSLKDNATLLTQVQTTMRENLSTVEGNFANIDERMKKLGK
NT seq 1227 nt   +upstreamnt  +downstreamnt
atggcggaccctaaatacgccgaccttcccggcattgccaggaacgagccagatgtttat
gaaaccagcgacctacctgaggatgaccaagcggagtttgatgcgtttgcacaagagctg
gaggagctgacaagcacaagtgtggaacacatcattgtcaatcccaatgctgcctatgac
aagttcaaagacaagagagtggggacaaagggacttgatttctcagatcgaattggaaaa
accaagaggacaggatatgaatctggagaatatgagatgcttggagagggtctgggagtg
aaagagacaccccagcaaaaatatcagcgactcctgcatgaggtccaagagctgacaagc
gaagtcgagaaaatcaagacagcagtgaaggagtcagccactgaggagaagctgaccccc
gtggtgctggctaaacagctggcagccctgaagcagcagctgcttgcttcccacctggag
aagctgctgggaccagatgcagcgatcaaccttactgaccccgatggagctctggctaag
cgtctgctgctgcagctggaagcaacaaagaacagcaaaggggctggttcagggggaaag
accacaagtgggaccttcccagatggcagcctagtcacttatgaactgcattctcggcct
gagcaggacaagttctctcaaactgccaaagttgcagaacttgagaggcgcctgacagag
ctggaagcaactgtacgctgtgatcaagatgcccagaatcccctctctgcaggtctacag
ggagcctgccttacggaaactgtagagctgttgcaggcaaaagtgagcgccctggacctt
gcagttttggaccaagtggaggctcggctacagagtgttctgggaaagatgaatgagatt
gccaagcataaagcttctgtagaggatgcagatacacaaagcaaggtgcaccagctatat
gaaaccatacagcgttggagccccatcgcttccacccttcctgagctggtgcagagactt
gtcaccatcaagcagctacatgagcaagccatgcagttcagtcagctcctgacacacttg
gataccacacagcagatgataactagttccctcaaggacaatgccaccctcttgacccag
gtacagacaaccatgcgtgaaaacctgtctacagttgaggggaattttgccaacattgat
gaacggatgaagaagctgggaaagtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107502898
Entry
107502898         CDS       T06036                                 

Gene name
DCTN1
Definition
(RefSeq) dynactin subunit 1 isoform X1
  KO
K04648  dynactin 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04962  Vasopressin-regulated water reabsorption
ray05014  Amyotrophic lateral sclerosis
ray05016  Huntington disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107502898 (DCTN1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    107502898 (DCTN1)
   05016 Huntington disease
    107502898 (DCTN1)
   05022 Pathways of neurodegeneration - multiple diseases
    107502898 (DCTN1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107502898 (DCTN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107502898 (DCTN1)
   03036 Chromosome and associated proteins [BR:ray03036]
    107502898 (DCTN1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107502898 (DCTN1)
Membrane trafficking [BR:ray04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab associated proteins
    107502898 (DCTN1)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Dynactin complex
     107502898 (DCTN1)
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dynactins
     107502898 (DCTN1)
SSDB
Motif
Pfam: Dynactin CAP_GLY Fez1
Other DBs
NCBI-GeneID: 107502898
NCBI-ProteinID: XP_015986087
LinkDB
Position
Unknown
AA seq 1282 aa
MAQSKRHVYSRAPSGSRMSAEASARPLRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGV
ILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVFEDGADTTSPETPDSSASKILKRE
GTDSAAKTSKLRGLKPKKAPTARKTTTRRPKPTRPASSTGVAGASSSLGPSGSASAGELS
SSEPSTPAQTPLAAPIIPTPALTSPGAAPPLPSPSKEEEGLRAQVRDLEEKLETLRLKRA
EDKAKLKELEKHKIQLEQVQEWKSKMQEQQADLQRRLKEARKEAKEALEAKERYMEEMAD
TADAIEMATLDKEMAEERAESLQQEVEALKERVDELTTDLEILKAEIEEKGSDGAASSYQ
LKQLEEQNARLKDALVRMRDLSSSEKQEHVKLQKLMEKKNQELEVVRQQRERLQEELSQA
ESTIDELKEQVDAALGAEEMVEMLTDRNLNLEEKVRELRETVGDLEAMNEMNDELQENAR
ETELELREQLDMAGARVREAQKRVEAAQETVADYQQTIKKYRQLTAHLQDVNRELTNQQE
ASVERQQQPPPETFDFKIKFAETKAHAKAIEMELRQMEVAQANRHMSLMTAFMPDSFLRP
GGDHDCVLVLLLMPRLICKAELIRKQAQEKFDLSENCSERPGLRGAAGEQLSFAAGLVYS
LSLLQATLHRYEHALSQCNVDVYKKVGSLYPEMSAHERSLDFLIELLHKDQLDETVNVEP
LTKAIKYYQHLYSIHLAEQPEDSTMQLADHIKFTQSALDCMSVEVGRLRAFLQGGQEASD
IALLLRDLETSCSDIRQFCKKIRRRMPGTDAPGIPAALAFGPQVSDTLLDCRKHLTWVVA
VLQEVAAAAAQLIAPLAENEGLPVAALEELAFKASEQIYGTPSSSPYECLRQSCSILIST
MNKLATAMQEGEYDAERPPSKPPPVELRAAALRAEITDAEGLGLKLEDRETVIKELKKSL
KIKGEELSEANVRLSLLEKKLDSAAKDADERIEKVQTRLEETQALLRKKEKEFEETMDAL
QADIDQLEAEKAELKQRLNSQSKRTIEGLRGPPPSGIATLVSGIAGEEQQRGGAPGQALG
SMPGPGLVRDSPLLLQQISAMRLHISQLQHENSILKGAQMKASLAALPPLHVAKLSLPPH
EGPGSELAAGSLYRKTNQLLETLNQLSAHTHVVDITRTSPAAKSPSAQLLEQVAQLKSLS
DTIEKLKDEVLKETVSQRPGATVPTDFATFPSSAFLRAKEEQQDDTVYMGKVTFSCAAGL
GQRHRLVLTQEQLHQLHCRLIS
NT seq 3849 nt   +upstreamnt  +downstreamnt
atggcccagagcaagaggcacgtgtatagccgggcgcccagtggcagcagaatgagtgca
gaggcaagcgcccggcctctgcgagtaggctcccgtgtggaggtgattggaaaagggcac
cgaggcactgtggcttatgttggagccacgctctttgccactggcaaatgggtaggtgtg
atcctagatgaagcaaaaggcaagaatgatggaactgtccaaggcaggaagtacttcact
tgtgatgaagggcatggcatctttgtgcgccaatcccagatccaagtatttgaagatgga
gcagatactacttccccagagacacctgattcttctgcctcaaagatcctcaaaagagag
ggaacagactcagctgcaaagaccagcaaactgcggggactgaagcctaagaaggcaccg
acagcccgaaagaccacaactcggcggcccaagcccacccgcccagccagtagtactggg
gtggccggagccagtagttccctaggcccctctggctcagcatcagccggtgagctgagt
agcagtgagcccagcaccccagctcagactccgctggcagcacccatcatccccacgcca
gccctcacctctcctggagcagcgcccccacttccttccccctccaaggaggaggagggg
ctgagggcccaggtgcgagacctagaggagaaactggagaccctgcggctgaaacgggca
gaagacaaggcaaagctaaaagagttggaaaaacacaagatccagctggagcaggtgcag
gaatggaagagcaagatgcaggagcagcaggctgacctgcagcgacgcctcaaggaggcg
cggaaggaagccaaggaggcactagaggcgaaggaacgctacatggaggagatggctgat
actgctgatgccattgagatggccactctggacaaggagatggctgaagagcgggctgag
tccctgcagcaggaggttgaggcgctgaaggagcgtgtggatgagctcaccactgacttg
gagatccttaaggctgaaattgaagagaaaggctcagatggagctgcgtctagttatcag
ctcaagcagctcgaggagcagaatgcccgcctaaaggatgccctggtgaggatgcgggat
ctttcttcttcagagaagcaggagcatgtgaaactccagaagctcatggaaaagaagaac
caagagctagaagttgtgaggcagcagcgggagcgtctgcaggaggagctgagccaggcg
gagagcaccatcgatgagctgaaggagcaggtggatgctgctctgggtgctgaggagatg
gtggagatgctgacagataggaacctgaatctagaagagaaagtgcgggaattgagagag
accgtgggggacttggaagcgatgaatgaaatgaacgatgagctgcaagagaatgcacgg
gagacagaattggagttgcgggagcagctggacatggctggcgcccgggttcgggaggcc
cagaagcgtgtggaggcagctcaggagacagttgcagactaccagcaaactatcaagaag
taccgccagttgaccgcccacttacaggatgtgaatcgggaactgacaaaccagcaggaa
gcatctgtggagcgtcagcagcagccacccccagagacttttgacttcaaaatcaagttt
gccgagactaaggcccatgccaaggctattgagatggaattgaggcagatggaggtggcc
caggccaatcggcacatgtccttgatgacagccttcatgcctgacagcttccttcggcca
ggtggggaccatgactgtgtcctggtgctgctgctcatgcctcgtctcatttgcaaggca
gagctgatccggaaacaggcccaggagaagtttgacctaagtgagaactgttcagagcgg
cctggtcttcgtggagctgcgggggagcagcttagctttgccgctgggctggtgtattca
ctgagtctgctgcaggccacactccaccgctatgagcacgcactctctcagtgcaatgtg
gacgtgtacaagaaggtgggcagcctctaccccgagatgagtgcccatgagcgctccttg
gacttcctcattgaactactgcacaaggaccagctggacgagactgtcaatgtcgagcct
ctcaccaaggccatcaagtactaccagcatctgtatagtatccaccttgccgaacagccc
gaggacagtaccatgcagctggctgaccacatcaagttcacccagagtgccctggactgc
atgagtgtggaggtgggacggctgcgtgccttcttgcagggtgggcaggaggcttcagat
attgccctcctgcttcgggacctggaaacgtcatgcagtgacatccgccagttctgcaag
aagatccgaaggagaatgccagggacagatgctcctgggatacccgctgcactagctttt
ggaccacaggtatccgacacactcctagactgcagaaaacacttgacgtgggtggtggct
gtgctgcaggaggtggcggctgctgctgcccagctcattgctccactggcggagaatgag
ggactgcctgtggctgccctggaggagctggctttcaaagcaagcgagcagatctatggg
accccatccagcagcccctatgagtgtctgcgccagtcatgcagcattctcatcagcacc
atgaacaagttggccacagccatgcaggagggagagtatgatgcagagcggccccccagc
aagcctcctcctgttgaactgcgggctgcagcccttcgtgcagagatcacagatgctgaa
ggcctgggcttgaagcttgaagatcgagagacagttatcaaggaattgaagaagtcactc
aagatcaagggggaggagctgagtgaggccaatgtgcggctaagcctcctggagaagaag
ctggacagtgctgccaaggatgcagatgagcgcatcgagaaagtccagactcggctggag
gaaacccaggcattgctgcggaagaaagaaaaagagttcgaagagacaatggatgcgctc
caggctgacattgaccagctagaggcagagaaggcagagctaaagcagcggctgaacagc
cagtcgaagcgcacgatcgagggcctccgggggccccctccctccggtattgctactctg
gtctctggcattgctggtgaagaacagcagcgaggaggcgcccccgggcaggctctgggg
tctatgccaggccctgggctggtgagggactcgccactgctacttcagcagatctctgcc
atgaggctgcacatctcccagctccagcatgagaacagcatcctcaagggagcgcaaatg
aaggcctccttagcagccctgccccctctgcatgtggcaaagctctccctcccaccccat
gagggccctggcagtgagctagcagctggatcgctgtatcgtaagaccaaccagctgctg
gagactttgaatcagctgagcgcgcacacccacgtagtagatatcacccgcaccagtcct
gctgccaagagcccgtcggcccagctcctggagcaagtggctcagctcaagtccctaagc
gacaccatcgagaagctcaaggatgaggtcctcaaggagactgtatcgcagcgccctgga
gccacggtccccactgacttcgccaccttcccttcctcagccttcctcagggccaaggag
gagcagcaggatgacactgtctacatgggcaaagtgaccttctcatgtgcggctggtctc
ggacagcgacaccggctggtgctgactcaggagcagctacaccagcttcactgtcgcctc
atctcctaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107505788
Entry
107505788         CDS       T06036                                 

Gene name
DCTN6
Definition
(RefSeq) dynactin subunit 6
  KO
K10428  dynactin 6
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04962  Vasopressin-regulated water reabsorption
ray05014  Amyotrophic lateral sclerosis
ray05016  Huntington disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107505788 (DCTN6)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    107505788 (DCTN6)
   05016 Huntington disease
    107505788 (DCTN6)
   05022 Pathways of neurodegeneration - multiple diseases
    107505788 (DCTN6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107505788 (DCTN6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ray03036]
    107505788 (DCTN6)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107505788 (DCTN6)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Dynactin complex
     107505788 (DCTN6)
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dynactins
     107505788 (DCTN6)
SSDB
Motif
Pfam: Hexapep
Other DBs
NCBI-GeneID: 107505788
NCBI-ProteinID: XP_015991609
LinkDB
Position
Unknown
AA seq 123 aa
MAEKIQKSVKIAPGAVVCVESEIKGDVTIGPRTVVHPKARIIAEAGPIVIGEGNLIEEQA
LIINAHPDNITPDTEDPEPKPMIIGTNNVFEVGCYSQAMRMGDNNVIESKGKLSSEKAQV
LLE
NT seq 372 nt   +upstreamnt  +downstreamnt
atggcggagaagattcaaaagagtgtgaagattgctcctggagcagttgtgtgtgtagaa
agtgaaatcaaaggtgatgtaactataggacctagaacagtggtccaccctaaagcacga
attattgcggaagccgggccaatagttattggtgaaggtaacctgatagaagaacaggcg
cttattataaatgctcaccctgataatatcacccctgacactgaagatccagagcccaaa
cctatgatcattggcaccaataatgtttttgaagttggctgttattcccaagccatgaga
atgggagataataatgttattgaatcaaaaggtaagctaagttccgaaaaggcacaagtc
ttattggagtaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107516090
Entry
107516090         CDS       T06036                                 

Gene name
DCTN5
Definition
(RefSeq) dynactin subunit 5
  KO
K10427  dynactin 5
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04962  Vasopressin-regulated water reabsorption
ray05014  Amyotrophic lateral sclerosis
ray05016  Huntington disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107516090 (DCTN5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    107516090 (DCTN5)
   05016 Huntington disease
    107516090 (DCTN5)
   05022 Pathways of neurodegeneration - multiple diseases
    107516090 (DCTN5)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107516090 (DCTN5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ray03036]
    107516090 (DCTN5)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107516090 (DCTN5)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Dynactin complex
     107516090 (DCTN5)
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dynactins
     107516090 (DCTN5)
SSDB
Motif
Pfam: Hexapep Hexapep_2 DUF4954 Fucokinase
Other DBs
NCBI-GeneID: 107516090
NCBI-ProteinID: XP_016010997
LinkDB
Position
Unknown
AA seq 182 aa
MELGELLYNKSEYIETASGNKVSRQSVLCGSQNIVLNGKTVVMNDCIIRGDLANVRVGRH
CVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGSYVHVGKNCVIGRRC
VLKDCCRILDNTVLPPETVVPPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKFLPLT
QV
NT seq 549 nt   +upstreamnt  +downstreamnt
atggagttgggcgagctgctctacaacaagtccgagtacatcgagacggcgtctgggaac
aaagttagccgccagtcagtgctgtgtggaagtcagaacatcgttctcaatggcaagacc
gtcgtgatgaacgactgcatcatccggggggatctggcgaatgtccgggttggacgtcat
tgcgttgtgaaaagtcggagtgtcataaggccaccgttcaagaaattcagcaaaggtgtc
gcgttcttccctttgcacatcggggaccacgtcttcattgaggaggattgtgtggtcaac
gcagctcagatcggctcttacgttcacgtcggcaagaactgtgtaattgggcgccggtgc
gtgctgaaagactgctgcagaattctcgacaacacagtattacccccagagactgtggtc
cccccgttcaccgtcttctcaggctgcccaggactcttctccggggagctccccgaatgc
acgcaggagctgatgatcgacgtcaccaagagctactaccagaagttcctgcccttgacg
caggtctga

DBGET integrated database retrieval system