KEGG   Rousettus aegyptiacus (Egyptian rousette): 107497167Help
Entry
107497167         CDS       T06036                                 

Gene name
CAMK2A
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit alpha isoform X1
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04012  ErbB signaling pathway
ray04020  Calcium signaling pathway
ray04024  cAMP signaling pathway
ray04066  HIF-1 signaling pathway
ray04114  Oocyte meiosis
ray04217  Necroptosis
ray04261  Adrenergic signaling in cardiomyocytes
ray04310  Wnt signaling pathway
ray04360  Axon guidance
ray04713  Circadian entrainment
ray04720  Long-term potentiation
ray04722  Neurotrophin signaling pathway
ray04725  Cholinergic synapse
ray04728  Dopaminergic synapse
ray04740  Olfactory transduction
ray04750  Inflammatory mediator regulation of TRP channels
ray04911  Insulin secretion
ray04912  GnRH signaling pathway
ray04916  Melanogenesis
ray04921  Oxytocin signaling pathway
ray04922  Glucagon signaling pathway
ray04925  Aldosterone synthesis and secretion
ray04934  Cushing syndrome
ray04971  Gastric acid secretion
ray05031  Amphetamine addiction
ray05152  Tuberculosis
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05214  Glioma
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107497167 (CAMK2A)
   04310 Wnt signaling pathway
    107497167 (CAMK2A)
   04066 HIF-1 signaling pathway
    107497167 (CAMK2A)
   04020 Calcium signaling pathway
    107497167 (CAMK2A)
   04024 cAMP signaling pathway
    107497167 (CAMK2A)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107497167 (CAMK2A)
   04217 Necroptosis
    107497167 (CAMK2A)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107497167 (CAMK2A)
   04922 Glucagon signaling pathway
    107497167 (CAMK2A)
   04912 GnRH signaling pathway
    107497167 (CAMK2A)
   04921 Oxytocin signaling pathway
    107497167 (CAMK2A)
   04916 Melanogenesis
    107497167 (CAMK2A)
   04925 Aldosterone synthesis and secretion
    107497167 (CAMK2A)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107497167 (CAMK2A)
  09154 Digestive system
   04971 Gastric acid secretion
    107497167 (CAMK2A)
  09156 Nervous system
   04725 Cholinergic synapse
    107497167 (CAMK2A)
   04728 Dopaminergic synapse
    107497167 (CAMK2A)
   04720 Long-term potentiation
    107497167 (CAMK2A)
   04722 Neurotrophin signaling pathway
    107497167 (CAMK2A)
  09157 Sensory system
   04740 Olfactory transduction
    107497167 (CAMK2A)
   04750 Inflammatory mediator regulation of TRP channels
    107497167 (CAMK2A)
  09158 Development and regeneration
   04360 Axon guidance
    107497167 (CAMK2A)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107497167 (CAMK2A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107497167 (CAMK2A)
   05205 Proteoglycans in cancer
    107497167 (CAMK2A)
  09162 Cancer: specific types
   05214 Glioma
    107497167 (CAMK2A)
  09165 Substance dependence
   05031 Amphetamine addiction
    107497167 (CAMK2A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107497167 (CAMK2A)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107497167 (CAMK2A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107497167 (CAMK2A)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     107497167 (CAMK2A)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   107497167 (CAMK2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CaMKII_AD Pkinase_Tyr SnoaL_3 DUF4440 APH Kdo SnoaL_2 SnoaL_4
Motif
Other DBs
NCBI-GeneID: 107497167
NCBI-ProteinID: XP_015974242
LinkDB All DBs
Position
Unknown
AA seq 489 aa AA seqDB search
MATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLERE
ARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQIL
EAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYL
SPEVLRKDPYGKPVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTV
TPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRKLK
GAILTTMLATRNFSGGKSGGNKKNDGVKKRKSSSSVQLMESSESTNTTIEDEDTKVRKQE
IIKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKP
VHTTILNPHIHLMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDGKWQIVHFHR
SGAPSVLPH
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggccaccatcacctgcacccgcttcacggaagagtaccagctcttcgaggaactggga
aagggagccttctccgtggtgcgtaggtgcgtgaaggtgctggctggccaggagtatgct
gccaagatcatcaacaccaagaagctctcagccagagatcatcagaagctggagcgtgaa
gcccgcatctgccgcctgctgaagcaccccaacattgtccggctccacgacagcatctct
gaggagggacaccattacctgatcttcgacctggtcaccggtggggagctgtttgaggac
attgtggcccgggagtattacagcgaggccgatgccagtcactgtatccagcagatcctg
gaggccgtgctgcactgccaccagatgggggtggtgcaccgggaccttaagccggagaat
ctgctgctggcctccaagctcaagggcgctgcagtgaagctggcagactttggcctggcc
atagaggtggagggggagcagcaggcatggttcgggttcgcagggacacctggatacctc
tccccagaagtgctgcgaaaggacccgtatgggaagcctgtagacctgtgggcctgtggg
gtcatcctgtacatcctgctagttgggtatcccccattctgggacgaggaccagcaccgg
ctgtaccagcagatcaaagccggcgcctatgatttcccatcaccagagtgggacaccgtc
actccggaagccaaggatctgatcaataagatgctgaccatcaacccgtccaaacgcatc
acggccgctgaggccctcaagcacccctggatctcgcaccgctccactgtggcctcctgc
atgcacagacaggagaccgtggactgcctgaagaagttcaatgccaggagaaaactgaag
ggagccatcctcaccacgatgttagccaccaggaacttctctggagggaagagtggagga
aacaagaagaacgatggtgtgaagaaaagaaagtccagttccagcgttcagttaatggaa
tcttcggagagcaccaacaccaccattgaggacgaagacaccaaagtgcggaaacaagaa
attataaaagtgacagagcagctgattgaagccataagcaatggagattttgagtcctac
acgaagatgtgcgaccccgggatgacggccttcgaacctgaggccctggggaacctggtc
gagggcctggacttccatcgattctattttgaaaacctgtggtcccggaacagcaaaccc
gtgcacaccaccatcctgaacccccacatccacctgatgggcgacgagtcggcctgcatc
gcctacatccgcatcacgcagtacctggacgccggcggcatcccgcgcacggcccagtcg
gaggagacccgcgtctggcaccgccgggacggcaaatggcagattgtccacttccacaga
tctggggcgccctccgtcctgccccattga

DBGET integrated database retrieval system