KEGG   Rousettus aegyptiacus (Egyptian rousette): 107497167
Entry
107497167         CDS       T06036                                 

Gene name
CAMK2A
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit alpha isoform X1
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04012  ErbB signaling pathway
ray04020  Calcium signaling pathway
ray04024  cAMP signaling pathway
ray04066  HIF-1 signaling pathway
ray04114  Oocyte meiosis
ray04217  Necroptosis
ray04261  Adrenergic signaling in cardiomyocytes
ray04310  Wnt signaling pathway
ray04360  Axon guidance
ray04713  Circadian entrainment
ray04720  Long-term potentiation
ray04722  Neurotrophin signaling pathway
ray04725  Cholinergic synapse
ray04728  Dopaminergic synapse
ray04740  Olfactory transduction
ray04750  Inflammatory mediator regulation of TRP channels
ray04911  Insulin secretion
ray04912  GnRH signaling pathway
ray04916  Melanogenesis
ray04921  Oxytocin signaling pathway
ray04922  Glucagon signaling pathway
ray04925  Aldosterone synthesis and secretion
ray04934  Cushing syndrome
ray04971  Gastric acid secretion
ray05012  Parkinson disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05031  Amphetamine addiction
ray05152  Tuberculosis
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05214  Glioma
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107497167 (CAMK2A)
   04310 Wnt signaling pathway
    107497167 (CAMK2A)
   04066 HIF-1 signaling pathway
    107497167 (CAMK2A)
   04020 Calcium signaling pathway
    107497167 (CAMK2A)
   04024 cAMP signaling pathway
    107497167 (CAMK2A)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107497167 (CAMK2A)
   04217 Necroptosis
    107497167 (CAMK2A)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107497167 (CAMK2A)
   04922 Glucagon signaling pathway
    107497167 (CAMK2A)
   04912 GnRH signaling pathway
    107497167 (CAMK2A)
   04921 Oxytocin signaling pathway
    107497167 (CAMK2A)
   04916 Melanogenesis
    107497167 (CAMK2A)
   04925 Aldosterone synthesis and secretion
    107497167 (CAMK2A)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107497167 (CAMK2A)
  09154 Digestive system
   04971 Gastric acid secretion
    107497167 (CAMK2A)
  09156 Nervous system
   04725 Cholinergic synapse
    107497167 (CAMK2A)
   04728 Dopaminergic synapse
    107497167 (CAMK2A)
   04720 Long-term potentiation
    107497167 (CAMK2A)
   04722 Neurotrophin signaling pathway
    107497167 (CAMK2A)
  09157 Sensory system
   04740 Olfactory transduction
    107497167 (CAMK2A)
   04750 Inflammatory mediator regulation of TRP channels
    107497167 (CAMK2A)
  09158 Development and regeneration
   04360 Axon guidance
    107497167 (CAMK2A)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107497167 (CAMK2A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107497167 (CAMK2A)
   05205 Proteoglycans in cancer
    107497167 (CAMK2A)
  09162 Cancer: specific types
   05214 Glioma
    107497167 (CAMK2A)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    107497167 (CAMK2A)
   05022 Pathways of neurodegeneration - multiple diseases
    107497167 (CAMK2A)
  09165 Substance dependence
   05031 Amphetamine addiction
    107497167 (CAMK2A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107497167 (CAMK2A)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107497167 (CAMK2A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107497167 (CAMK2A)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     107497167 (CAMK2A)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   107497167 (CAMK2A)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr SnoaL_3 DUF4440 APH Kdo SnoaL_2 SnoaL_4
Other DBs
NCBI-GeneID: 107497167
NCBI-ProteinID: XP_015974242
LinkDB
Position
Unknown
AA seq 489 aa
MATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLERE
ARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQIL
EAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYL
SPEVLRKDPYGKPVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTV
TPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRKLK
GAILTTMLATRNFSGGKSGGNKKNDGVKKRKSSSSVQLMESSESTNTTIEDEDTKVRKQE
IIKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKP
VHTTILNPHIHLMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDGKWQIVHFHR
SGAPSVLPH
NT seq 1470 nt   +upstreamnt  +downstreamnt
atggccaccatcacctgcacccgcttcacggaagagtaccagctcttcgaggaactggga
aagggagccttctccgtggtgcgtaggtgcgtgaaggtgctggctggccaggagtatgct
gccaagatcatcaacaccaagaagctctcagccagagatcatcagaagctggagcgtgaa
gcccgcatctgccgcctgctgaagcaccccaacattgtccggctccacgacagcatctct
gaggagggacaccattacctgatcttcgacctggtcaccggtggggagctgtttgaggac
attgtggcccgggagtattacagcgaggccgatgccagtcactgtatccagcagatcctg
gaggccgtgctgcactgccaccagatgggggtggtgcaccgggaccttaagccggagaat
ctgctgctggcctccaagctcaagggcgctgcagtgaagctggcagactttggcctggcc
atagaggtggagggggagcagcaggcatggttcgggttcgcagggacacctggatacctc
tccccagaagtgctgcgaaaggacccgtatgggaagcctgtagacctgtgggcctgtggg
gtcatcctgtacatcctgctagttgggtatcccccattctgggacgaggaccagcaccgg
ctgtaccagcagatcaaagccggcgcctatgatttcccatcaccagagtgggacaccgtc
actccggaagccaaggatctgatcaataagatgctgaccatcaacccgtccaaacgcatc
acggccgctgaggccctcaagcacccctggatctcgcaccgctccactgtggcctcctgc
atgcacagacaggagaccgtggactgcctgaagaagttcaatgccaggagaaaactgaag
ggagccatcctcaccacgatgttagccaccaggaacttctctggagggaagagtggagga
aacaagaagaacgatggtgtgaagaaaagaaagtccagttccagcgttcagttaatggaa
tcttcggagagcaccaacaccaccattgaggacgaagacaccaaagtgcggaaacaagaa
attataaaagtgacagagcagctgattgaagccataagcaatggagattttgagtcctac
acgaagatgtgcgaccccgggatgacggccttcgaacctgaggccctggggaacctggtc
gagggcctggacttccatcgattctattttgaaaacctgtggtcccggaacagcaaaccc
gtgcacaccaccatcctgaacccccacatccacctgatgggcgacgagtcggcctgcatc
gcctacatccgcatcacgcagtacctggacgccggcggcatcccgcgcacggcccagtcg
gaggagacccgcgtctggcaccgccgggacggcaaatggcagattgtccacttccacaga
tctggggcgccctccgtcctgccccattga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107498266
Entry
107498266         CDS       T06036                                 

Gene name
CAMK2G
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit gamma isoform X1
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04012  ErbB signaling pathway
ray04020  Calcium signaling pathway
ray04024  cAMP signaling pathway
ray04066  HIF-1 signaling pathway
ray04114  Oocyte meiosis
ray04217  Necroptosis
ray04261  Adrenergic signaling in cardiomyocytes
ray04310  Wnt signaling pathway
ray04360  Axon guidance
ray04713  Circadian entrainment
ray04720  Long-term potentiation
ray04722  Neurotrophin signaling pathway
ray04725  Cholinergic synapse
ray04728  Dopaminergic synapse
ray04740  Olfactory transduction
ray04750  Inflammatory mediator regulation of TRP channels
ray04911  Insulin secretion
ray04912  GnRH signaling pathway
ray04916  Melanogenesis
ray04921  Oxytocin signaling pathway
ray04922  Glucagon signaling pathway
ray04925  Aldosterone synthesis and secretion
ray04934  Cushing syndrome
ray04971  Gastric acid secretion
ray05012  Parkinson disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05031  Amphetamine addiction
ray05152  Tuberculosis
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05214  Glioma
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107498266 (CAMK2G)
   04310 Wnt signaling pathway
    107498266 (CAMK2G)
   04066 HIF-1 signaling pathway
    107498266 (CAMK2G)
   04020 Calcium signaling pathway
    107498266 (CAMK2G)
   04024 cAMP signaling pathway
    107498266 (CAMK2G)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107498266 (CAMK2G)
   04217 Necroptosis
    107498266 (CAMK2G)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107498266 (CAMK2G)
   04922 Glucagon signaling pathway
    107498266 (CAMK2G)
   04912 GnRH signaling pathway
    107498266 (CAMK2G)
   04921 Oxytocin signaling pathway
    107498266 (CAMK2G)
   04916 Melanogenesis
    107498266 (CAMK2G)
   04925 Aldosterone synthesis and secretion
    107498266 (CAMK2G)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107498266 (CAMK2G)
  09154 Digestive system
   04971 Gastric acid secretion
    107498266 (CAMK2G)
  09156 Nervous system
   04725 Cholinergic synapse
    107498266 (CAMK2G)
   04728 Dopaminergic synapse
    107498266 (CAMK2G)
   04720 Long-term potentiation
    107498266 (CAMK2G)
   04722 Neurotrophin signaling pathway
    107498266 (CAMK2G)
  09157 Sensory system
   04740 Olfactory transduction
    107498266 (CAMK2G)
   04750 Inflammatory mediator regulation of TRP channels
    107498266 (CAMK2G)
  09158 Development and regeneration
   04360 Axon guidance
    107498266 (CAMK2G)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107498266 (CAMK2G)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107498266 (CAMK2G)
   05205 Proteoglycans in cancer
    107498266 (CAMK2G)
  09162 Cancer: specific types
   05214 Glioma
    107498266 (CAMK2G)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    107498266 (CAMK2G)
   05022 Pathways of neurodegeneration - multiple diseases
    107498266 (CAMK2G)
  09165 Substance dependence
   05031 Amphetamine addiction
    107498266 (CAMK2G)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107498266 (CAMK2G)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107498266 (CAMK2G)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107498266 (CAMK2G)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     107498266 (CAMK2G)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   107498266 (CAMK2G)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr SnoaL_3 DUF4440 APH Pkinase_fungal Kdo SnoaL_2 RIO1
Other DBs
NCBI-GeneID: 107498266
NCBI-ProteinID: XP_015976644
LinkDB
Position
Unknown
AA seq 588 aa
MATTATCTRFTDDYQLFEELGKGAFSVVRRCVKKTSTQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQI
LESVNHIHQHDIVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGEQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDT
VTPEAKNLINQMLTINPAKRITADQALKHPWVCQRSTVASMMHRQETVECLRKFNARRKL
KGAILTTMLVSRNFSVGRQSSAPASPAASAASLAGQAAKSLLNKKSDGGVKKRKSSSSVH
LMPQSNNKNSLVSPAQDPAPLQTAMEPQTTVVHNATDGIKGSTESCNTTTEDEDLKAAPL
RTGNGSSVPEGRSSRDRTAPSAGMQPQPSLCSSAMRKQEIIKITEQLIEAINNGDFEAYT
KICDPGLTSFEPEALGNLVEGMDFHKFYFENLLSKNSKPIHTTILNPHVHVIGEDAACIA
YIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWLNVHYHCSGAPAAPLQ
NT seq 1767 nt   +upstreamnt  +downstreamnt
atggccaccaccgccacctgcacccgcttcaccgacgactaccagcttttcgaggagctt
ggcaagggtgctttctctgtggtccgcaggtgtgtgaagaaaacctccacgcaggagtat
gcagcaaaaatcatcaataccaagaagttgtctgcgcgggatcaccagaagctagaacgt
gaggcccggatatgccgacttttgaaacacccaaacattgtgcgtctccatgacagtatt
tctgaagaagggtttcactacctcgtgtttgaccttgttaccggcggagagctgtttgaa
gacatcgtggccagagaatactatagcgaagctgatgccagccactgtatacatcagatt
ctggagagtgttaaccacatccaccagcatgacattgtccaccgagacctgaagcccgag
aacctgctgctggcaagtaaatgcaagggtgccgcagtcaagttggctgattttggacta
gccatcgaagtacagggcgagcagcaggcttggtttggttttgctggcaccccaggttac
ttgtcccctgaggtcttgagaaaagatccctatggaaaacctgtggatatctgggcctgc
ggggttatcctgtatattctcctggtgggataccctcccttctgggatgaggatcaacac
aagctatatcagcagatcaaggccggagcctatgatttcccatcaccagagtgggacacg
gtgactcctgaagccaagaacttgatcaatcagatgttaaccataaaccctgcaaaacgt
atcacagctgaccaggctctcaagcatccatgggtctgccaacgatccacggtggcatcc
atgatgcatcgtcaagagactgtggagtgcttgcgcaagttcaatgcccggagaaaactg
aagggtgccatcctcacgaccatgcttgtctccaggaacttttcagttggcaggcagagc
tccgcccccgcctcgcctgccgcgagcgccgccagcctggctgggcaagctgccaaaagt
ctattgaacaagaagtcagatggtggtgtcaagaaaaggaagtcgagttccagcgtgcac
ctaatgccacagagcaacaacaaaaacagtctcgtaagcccagcccaagatcccgcgccc
ttgcagacggccatggagccacaaaccaccgtggtacacaacgctacagatgggatcaag
ggttccacggagagctgtaacaccaccacagaagatgaggacctcaaagctgccccgctc
cgcactgggaatggcagctcggtgcctgaaggacggagctcccgggacagaacagctccc
tctgcaggcatgcagccccagccttctctctgctcctcagccatgcgaaaacaggagatc
attaagatcacagaacaactgattgaggccattaacaatggggactttgaggcttacacg
aagatttgcgatccaggcctcacttcgtttgagcctgaggcccttggtaacctcgtggag
ggaatggatttccataagttttactttgagaatctcttatccaagaacagcaagcccatt
cacaccaccatcctgaacccacatgtccatgtgatcggagaggacgcagcttgcatcgct
tacatccgcctcactcagtacatcgatgggcagggccggcctcgcaccagccagtcggag
gagactcgggtctggcaccgccgggatggcaagtggctcaatgtccactatcactgctca
ggggcccctgctgcaccgctgcagtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107504874
Entry
107504874         CDS       T06036                                 

Gene name
CAMK1
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type 1 isoform X1
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04020  Calcium signaling pathway
ray04921  Oxytocin signaling pathway
ray04925  Aldosterone synthesis and secretion
ray05214  Glioma
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107504874 (CAMK1)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107504874 (CAMK1)
   04925 Aldosterone synthesis and secretion
    107504874 (CAMK1)
 09160 Human Diseases
  09162 Cancer: specific types
   05214 Glioma
    107504874 (CAMK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107504874 (CAMK1)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     107504874 (CAMK1)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   107504874 (CAMK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal Kdo APH RIO1 Tyrosinase YrbL-PhoP_reg
Other DBs
NCBI-GeneID: 107504874
NCBI-ProteinID: XP_015989977
LinkDB
Position
Unknown
AA seq 346 aa
MTTGGAFSEVILAEDKRTQKLVAIKCIAKKALEGKEGSMENEIAVLHKIKHPNIVALDDI
YESGGHLYLIMQLVSGGELFDRIVEKGFYTERDASRLIFQVLDAVKYLHDLGIVHRDLKP
ENLLYYSLDEDSKIMISDFGLSKMEDPGSVLSTACGTPGYVAPEVLAQKPYSKAVDCWSI
GVIAYILLCGYPPFYDENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIQHLMEKDPEKR
FTCEQALQHPWIAGDTALDKNIHQSVSEQIKKNFAKSKWKQAFNATAVVRHMRKLQLGTS
QEGQGQTASHGELLTPAAGGPVAGCCCRDCCVEPGPELSPTLPPQL
NT seq 1041 nt   +upstreamnt  +downstreamnt
atgacaacaggaggggccttctcagaggtaatcctggcagaagataagagaactcagaag
ctggtggccatcaaatgcattgccaagaaggctctggagggcaaggagggcagcatggag
aatgagattgctgtgctccacaagatcaagcaccccaacattgttgccctagatgacatc
tatgagagtgggggccacctctacctcataatgcagctggtgtcgggaggggagctgttt
gaccgcattgtggaaaaaggcttctacacagagcgagatgccagccgcctcatcttccag
gtgctggatgctgtcaagtacctgcatgacctgggcatcgtacaccgggacctcaagcca
gagaatctgctatactacagcctggacgaagactccaaaatcatgatctccgactttggc
ctctccaagatggaggaccctggcagtgtgctctccacagcctgcggaaccccgggatac
gtggcccctgaggtcctggcccagaagccctacagcaaggcagtggattgctggtccatt
ggcgtcattgcctacatcctgctctgcggttacccccccttctatgacgagaatgatgcc
aaactctttgaacagattttgaaggccgagtacgagtttgactctccttactgggacgac
atctctgattctgccaaagacttcatccagcacttgatggagaaggatccagagaagagg
ttcacctgtgagcaggccttgcaacacccgtggattgcaggagatacagctctagataag
aatattcatcagtcagtgagtgagcagatcaagaagaactttgccaagagcaagtggaag
caagccttcaatgccacggcagtggtgcggcacatgaggaagctgcagctgggcaccagc
caggaggggcagggacagacagcaagccacggggaactgctgacaccagcagctgggggg
ccagtggctggctgctgttgtcgagactgctgtgtggagccaggcccggagctgtccccc
acactgccgccccagctctag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107506545
Entry
107506545         CDS       T06036                                 

Gene name
CAMK4
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type IV
  KO
K05869  calcium/calmodulin-dependent protein kinase IV [EC:2.7.11.17]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04020  Calcium signaling pathway
ray04024  cAMP signaling pathway
ray04211  Longevity regulating pathway
ray04371  Apelin signaling pathway
ray04380  Osteoclast differentiation
ray04720  Long-term potentiation
ray04722  Neurotrophin signaling pathway
ray04725  Cholinergic synapse
ray04921  Oxytocin signaling pathway
ray04925  Aldosterone synthesis and secretion
ray05031  Amphetamine addiction
ray05034  Alcoholism
ray05214  Glioma
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107506545 (CAMK4)
   04020 Calcium signaling pathway
    107506545 (CAMK4)
   04024 cAMP signaling pathway
    107506545 (CAMK4)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107506545 (CAMK4)
   04925 Aldosterone synthesis and secretion
    107506545 (CAMK4)
  09156 Nervous system
   04725 Cholinergic synapse
    107506545 (CAMK4)
   04720 Long-term potentiation
    107506545 (CAMK4)
   04722 Neurotrophin signaling pathway
    107506545 (CAMK4)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107506545 (CAMK4)
  09149 Aging
   04211 Longevity regulating pathway
    107506545 (CAMK4)
 09160 Human Diseases
  09162 Cancer: specific types
   05214 Glioma
    107506545 (CAMK4)
  09165 Substance dependence
   05031 Amphetamine addiction
    107506545 (CAMK4)
   05034 Alcoholism
    107506545 (CAMK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107506545 (CAMK4)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     107506545 (CAMK4)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   107506545 (CAMK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like FTA2 Kdo Pkinase_fungal YrbL-PhoP_reg APH Totivirus_coat
Other DBs
NCBI-GeneID: 107506545
NCBI-ProteinID: XP_015992737
LinkDB
Position
Unknown
AA seq 470 aa
MLKVTVPSCSASSCSSVTASVAPGAGTLVPDYWIDGSNRDALSDFFEVESELGRGATSIV
YRCKQKGTQKPYALKVLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLEL
VTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAPDAP
LKIADFGLSKIVEHQVLMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGVITYILLCGFEP
FYDERGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVKKLIVLDPKKRLTTFQALQHPWV
TGKAANFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLGSASSSHGSIQESQKASQEPS
PIQDGNEGVKAFPEGEKVQVDVAQVAVESAKAELMKGQEAEEVKDAAISAANPVKMVPEA
LEDGIKVADPEIEEGSVEEKLKTEEASKEGQENPALGVVAQQNDAILPEY
NT seq 1413 nt   +upstreamnt  +downstreamnt
atgctcaaagtcacggtgccctcgtgctcggcctcgtcctgttcttcggtcaccgccagt
gtggccccaggggccgggaccctcgtcccggattactggatcgacggctccaacagggat
gctttgagcgatttcttcgaggtggagtcggaactgggacggggagctacatccattgtg
tacagatgcaaacagaaggggacccagaagccttatgctctcaaagtgttaaagaaaaca
gtggacaaaaaaatcgtaagaactgaaataggagttcttcttcgcctctcacatccaaac
attataaaacttaaagagatatttgaaacccctacagaaatcagtctggtcctagaactt
gtcacaggaggagaactgtttgacaggattgtagaaaaaggatattatagtgaacgagat
gctgcagatgctgttaaacaaatcctggaggcagttgcttacctacatgaaaatggaatt
gtccatcgtgatctcaaaccagagaaccttctctatgcaactccagccccagatgcaccg
ctcaaaattgctgattttggactctctaaaattgtggaacatcaagtgctcatgaagaca
gtatgtggaaccccagggtactgcgcacctgaaattcttagaggctgtgcctatggaccc
gaggtggatatgtggtctgtaggagtcatcacctacatcttactttgtggattcgaacca
ttctatgatgaaagaggcgatcagttcatgttcaggagaattctgaattgtgaatattac
tttatctccccctggtgggatgaagtatctctaaatgccaaggacttggtcaaaaaatta
attgttttggatcctaagaaacggctgactaccttccaagctctgcagcacccgtgggtc
acaggtaaagcagccaattttgtacacatggataccgctcagaagaagctccaagaattc
aatgcccgacgcaagcttaaggcagcagtgaaggctgtggtggcctcatcacggttggga
agtgccagcagtagccacggcagcatccaggagagccaaaaggccagccaagagccatct
ccaatccaagacggcaatgaaggtgttaaagctttcccagaaggagagaaagttcaagtc
gatgtggcccaagtggcagttgagagtgcaaaggctgagctgatgaaggggcaggaggca
gaggaagttaaagatgctgctataagtgctgccaatcccgtcaagatggtgcccgaggca
ttagaggatgggataaaggtggccgacccggaaatagaagagggctcggtggaggagaag
ctgaagactgaggaagcctccaaagaagggcaagaaaatcctgctctgggtgttgttgct
cagcagaatgatgcgatcctgccagagtactaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107510894
Entry
107510894         CDS       T06036                                 

Gene name
CAMK2D
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit delta isoform X1
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04012  ErbB signaling pathway
ray04020  Calcium signaling pathway
ray04024  cAMP signaling pathway
ray04066  HIF-1 signaling pathway
ray04114  Oocyte meiosis
ray04217  Necroptosis
ray04261  Adrenergic signaling in cardiomyocytes
ray04310  Wnt signaling pathway
ray04360  Axon guidance
ray04713  Circadian entrainment
ray04720  Long-term potentiation
ray04722  Neurotrophin signaling pathway
ray04725  Cholinergic synapse
ray04728  Dopaminergic synapse
ray04740  Olfactory transduction
ray04750  Inflammatory mediator regulation of TRP channels
ray04911  Insulin secretion
ray04912  GnRH signaling pathway
ray04916  Melanogenesis
ray04921  Oxytocin signaling pathway
ray04922  Glucagon signaling pathway
ray04925  Aldosterone synthesis and secretion
ray04934  Cushing syndrome
ray04971  Gastric acid secretion
ray05012  Parkinson disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05031  Amphetamine addiction
ray05152  Tuberculosis
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05214  Glioma
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107510894 (CAMK2D)
   04310 Wnt signaling pathway
    107510894 (CAMK2D)
   04066 HIF-1 signaling pathway
    107510894 (CAMK2D)
   04020 Calcium signaling pathway
    107510894 (CAMK2D)
   04024 cAMP signaling pathway
    107510894 (CAMK2D)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107510894 (CAMK2D)
   04217 Necroptosis
    107510894 (CAMK2D)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107510894 (CAMK2D)
   04922 Glucagon signaling pathway
    107510894 (CAMK2D)
   04912 GnRH signaling pathway
    107510894 (CAMK2D)
   04921 Oxytocin signaling pathway
    107510894 (CAMK2D)
   04916 Melanogenesis
    107510894 (CAMK2D)
   04925 Aldosterone synthesis and secretion
    107510894 (CAMK2D)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107510894 (CAMK2D)
  09154 Digestive system
   04971 Gastric acid secretion
    107510894 (CAMK2D)
  09156 Nervous system
   04725 Cholinergic synapse
    107510894 (CAMK2D)
   04728 Dopaminergic synapse
    107510894 (CAMK2D)
   04720 Long-term potentiation
    107510894 (CAMK2D)
   04722 Neurotrophin signaling pathway
    107510894 (CAMK2D)
  09157 Sensory system
   04740 Olfactory transduction
    107510894 (CAMK2D)
   04750 Inflammatory mediator regulation of TRP channels
    107510894 (CAMK2D)
  09158 Development and regeneration
   04360 Axon guidance
    107510894 (CAMK2D)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107510894 (CAMK2D)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107510894 (CAMK2D)
   05205 Proteoglycans in cancer
    107510894 (CAMK2D)
  09162 Cancer: specific types
   05214 Glioma
    107510894 (CAMK2D)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    107510894 (CAMK2D)
   05022 Pathways of neurodegeneration - multiple diseases
    107510894 (CAMK2D)
  09165 Substance dependence
   05031 Amphetamine addiction
    107510894 (CAMK2D)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107510894 (CAMK2D)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107510894 (CAMK2D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107510894 (CAMK2D)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     107510894 (CAMK2D)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   107510894 (CAMK2D)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr DUF4440 SnoaL_3 Pkinase_fungal SnoaL_2 Kdo SnoaL_4 DUF4915
Other DBs
NCBI-GeneID: 107510894
NCBI-ProteinID: XP_016000322
LinkDB
Position
Unknown
AA seq 512 aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI
LESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDT
VTPEAKDLINKMLTINPAKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRKL
KGAILTTMLATRNFSAAKSLLKKPDGVKINSKAHVVTSPKENAPPPALEPQTTVIHNPDG
NKESTESSNTTIEDEDVKARKQEIIKVTEQLIEAINNGDFEAYTKICDPGLTAFEPEALG
NLVEGMDFHRFYFENALSKSNKPVHTIILNPHVHLVGEDAACIAYVRLTQYMDGGGVPKT
MQSEETRVWHRRDGKWQNVHFHRSGSPTVPAS
NT seq 1539 nt   +upstreamnt  +downstreamnt
atggcctctaccaccacctgcacccggttcacagatgagtaccagctcttcgaggagctc
ggaaagggggctttctcggtggtgagaagatgcatgaaaatccctactggacaagaatat
gctgcaaaaatcatcaacaccaagaaactctccgccagggatcatcagaagctggaaagg
gaagccaggatctgccgtcttctgaagcaccccaatatcgtgcgacttcatgacagcata
tccgaagagggcttccactacctggtgtttgacctagtcacgggcggcgagctgtttgaa
gacatcgtggccagggagtactacagcgaggcggacgccagtcattgcatacagcagatt
ctagagagtgtaaatcactgtcacctaaacggcatagtgcacagggacctgaagcctgag
aatttgcttttagctagcaaatccaagggagcggccgtgaaactcgcagattttggcttg
gccatagaagttcaaggggaccagcaggcctggtttggattcgccggcacacccgggtac
ctgtctccggaggttttgcgcaaagacccttatgggaagccggtggacatgtgggcgtgc
ggcgtgatcctctacatcctgcttgtgggctacccgcccttctgggacgaggaccagcac
cggctgtaccagcagatcaaggccggagcctacgactttccgtcgccggagtgggacacg
gtgactcccgaagccaaagatctcatcaacaaaatgctgaccatcaaccccgccaagcgc
atcaccgcgtccgaggctctgaaacacccgtggatttgccaacgctccacggtggcctcc
atgatgcacaggcaagagaccgtcgactgcctgaagaagttcaacgcccggcggaagctg
aagggcgccatcctgacgacgatgctggccacgaggaacttctcagcagccaagagcttg
ttgaagaagccggacggggtgaagataaacagcaaggcccacgtggtaactagccccaaa
gagaatgccccccccccagcgctggagccccaaaccactgtaatccacaaccccgacgga
aacaaggaatcgacagagagctccaacacgaccatcgaggacgaagacgtgaaagcacgg
aagcaggagatcatcaaagtcacggagcagctgatcgaagccatcaacaacggggacttc
gaggcgtacacgaagatctgcgacccaggccttactgcttttgaacccgaagctctgggc
aatttagtggaaggaatggactttcatcgattctacttcgaaaatgctctgtccaagagc
aacaagccggtgcacaccatcatcctgaacccgcacgtgcacctggtgggcgaggatgcc
gcctgcatcgcctacgtcaggctcacgcagtacatggacggcggcggcgtgcccaagacc
atgcagtcggaggagacgcgcgtgtggcaccggcgagacggcaagtggcagaacgtgcac
ttccaccgctcggggtcgcccacggtgcccgccagctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107512385
Entry
107512385         CDS       T06036                                 

Gene name
CAMK2B
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit beta isoform X1
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04012  ErbB signaling pathway
ray04020  Calcium signaling pathway
ray04024  cAMP signaling pathway
ray04066  HIF-1 signaling pathway
ray04114  Oocyte meiosis
ray04217  Necroptosis
ray04261  Adrenergic signaling in cardiomyocytes
ray04310  Wnt signaling pathway
ray04360  Axon guidance
ray04713  Circadian entrainment
ray04720  Long-term potentiation
ray04722  Neurotrophin signaling pathway
ray04725  Cholinergic synapse
ray04728  Dopaminergic synapse
ray04740  Olfactory transduction
ray04750  Inflammatory mediator regulation of TRP channels
ray04911  Insulin secretion
ray04912  GnRH signaling pathway
ray04916  Melanogenesis
ray04921  Oxytocin signaling pathway
ray04922  Glucagon signaling pathway
ray04925  Aldosterone synthesis and secretion
ray04934  Cushing syndrome
ray04971  Gastric acid secretion
ray05012  Parkinson disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05031  Amphetamine addiction
ray05152  Tuberculosis
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05214  Glioma
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107512385 (CAMK2B)
   04310 Wnt signaling pathway
    107512385 (CAMK2B)
   04066 HIF-1 signaling pathway
    107512385 (CAMK2B)
   04020 Calcium signaling pathway
    107512385 (CAMK2B)
   04024 cAMP signaling pathway
    107512385 (CAMK2B)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107512385 (CAMK2B)
   04217 Necroptosis
    107512385 (CAMK2B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107512385 (CAMK2B)
   04922 Glucagon signaling pathway
    107512385 (CAMK2B)
   04912 GnRH signaling pathway
    107512385 (CAMK2B)
   04921 Oxytocin signaling pathway
    107512385 (CAMK2B)
   04916 Melanogenesis
    107512385 (CAMK2B)
   04925 Aldosterone synthesis and secretion
    107512385 (CAMK2B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107512385 (CAMK2B)
  09154 Digestive system
   04971 Gastric acid secretion
    107512385 (CAMK2B)
  09156 Nervous system
   04725 Cholinergic synapse
    107512385 (CAMK2B)
   04728 Dopaminergic synapse
    107512385 (CAMK2B)
   04720 Long-term potentiation
    107512385 (CAMK2B)
   04722 Neurotrophin signaling pathway
    107512385 (CAMK2B)
  09157 Sensory system
   04740 Olfactory transduction
    107512385 (CAMK2B)
   04750 Inflammatory mediator regulation of TRP channels
    107512385 (CAMK2B)
  09158 Development and regeneration
   04360 Axon guidance
    107512385 (CAMK2B)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107512385 (CAMK2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107512385 (CAMK2B)
   05205 Proteoglycans in cancer
    107512385 (CAMK2B)
  09162 Cancer: specific types
   05214 Glioma
    107512385 (CAMK2B)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    107512385 (CAMK2B)
   05022 Pathways of neurodegeneration - multiple diseases
    107512385 (CAMK2B)
  09165 Substance dependence
   05031 Amphetamine addiction
    107512385 (CAMK2B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107512385 (CAMK2B)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107512385 (CAMK2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107512385 (CAMK2B)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     107512385 (CAMK2B)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   107512385 (CAMK2B)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr DUF4440 SnoaL_3 SnoaL_2 APH Kdo Pkinase_fungal SnoaL_4
Other DBs
NCBI-GeneID: 107512385
NCBI-ProteinID: XP_016003343
LinkDB
Position
Unknown
AA seq 542 aa
MATTVTCTRFTDEYQLYEDIGKGAFSVVRRCVKLCTGHEYAAKIINTKKLSARDHQKLER
EARICRLLKHSNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI
LEAVLHCHQMGVVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKEAYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDT
VTPEAKNLINQMLTINPAKRITAHEALKHPWVCQRSTVASMMHRQETVECLKKFNARRKL
KGAILTTMLATRNFSVGRQTTAPASVSTAASGTTMGLVEQAKSLLNKKADGVKPQTNSTK
NSAAATSPKGTLPPAALEPQTTVIHNPVDGIKESSDSAHTTIEDEDTRARKQDIIKITEQ
LIEAVNNGDFEAYAKICDPGLTSFEPEALGNLVEGMDFHRFYFENLLAKNSKPIHTTILN
PHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWQNVHFHCSGAPGAP
LQ
NT seq 1629 nt   +upstreamnt  +downstreamnt
atggccaccacggtgacctgcactcgcttcacggacgagtaccagctctacgaagatatt
ggcaagggcgctttctctgtggtccgacgctgtgtcaagctctgcaccggccatgagtat
gcagccaagatcattaacaccaagaagctgtcggccagagatcaccagaagctggagaga
gaggctcggatctgccgcctcctgaagcactccaacatcgtgcgcctgcacgacagcatc
tcagaggagggcttccactacctggtcttcgatctggtcactggcggcgagctcttcgag
gacattgtggcgagagagtactacagcgaggcggatgccagccactgcatccagcagatc
ctggaggcggtgctccactgccaccagatgggggtcgtccacagggacctgaagcctgag
aacctgctcctggccagcaagtgcaagggcgcggccgtgaagctggcggacttcggcctg
gccatcgaggtgcagggcgaccagcaggcgtggttcgggtttgctggcacgccgggctac
ctgtcccccgaggtcctgcgcaaggaggcgtacggcaagccggtggacatctgggcgtgc
ggcgtgatcctgtacatcctgctcgtgggctacccgcccttctgggacgaggaccagcac
aagctgtaccagcagatcaaggccggagcctacgacttcccctcccccgagtgggacaca
gtcactcccgaagccaaaaacctcatcaaccagatgctgaccatcaaccccgccaagcgc
atcaccgcacacgaggcgctaaagcacccgtgggtctgccaacgctccacggtggcctcc
atgatgcacaggcaggagactgtggagtgcctgaagaagttcaatgcccggcggaagctc
aagggcgcgatcctcaccactatgctggccacgcggaacttctcagtgggcagacagacc
accgctccggcctcagtgtccaccgcggcctccggcaccaccatggggctggtggaacaa
gccaagagtctactcaacaagaaagcggacggagtcaagccccagacgaatagcaccaag
aacagtgcagctgccaccagccccaaggggacgcttcctccggccgccctggaacctcag
accaccgtcattcataacccggtggacgggatcaaggagtcctccgacagcgcccacacc
accatcgaggacgaggacacaagagcacggaagcaagacatcatcaagatcacggagcag
ctcatcgaggccgtgaacaatggcgacttcgaggcgtacgcgaagatctgcgacccgggc
ctgacctcgttcgagcctgaagccctgggcaacctggtcgaagggatggacttccacagg
ttctactttgagaacttgctcgccaaaaacagcaagcccatccacacgaccatcctgaac
ccgcacgtgcacgtcatcggggaggacgccgcctgcatcgcctacatccgcctcacgcag
tacatcgacgggcagggccggccccgcaccagccagtccgaggagacccgcgtgtggcac
cgcagggacggcaagtggcagaacgtgcacttccactgctcgggcgcgccaggggcgccg
ctgcagtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107517631
Entry
107517631         CDS       T06036                                 

Gene name
CAMK1G
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type 1G
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04020  Calcium signaling pathway
ray04921  Oxytocin signaling pathway
ray04925  Aldosterone synthesis and secretion
ray05214  Glioma
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107517631 (CAMK1G)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107517631 (CAMK1G)
   04925 Aldosterone synthesis and secretion
    107517631 (CAMK1G)
 09160 Human Diseases
  09162 Cancer: specific types
   05214 Glioma
    107517631 (CAMK1G)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107517631 (CAMK1G)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     107517631 (CAMK1G)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   107517631 (CAMK1G)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like FTA2 Kdo Pkinase_fungal APH RIO1 YrbL-PhoP_reg 5_nucleotid
Other DBs
NCBI-GeneID: 107517631
NCBI-ProteinID: XP_016014058
LinkDB
Position
Unknown
AA seq 476 aa
MGRKEEDDCSSWKKQTTNIRKTFVFMEVLGSGAFSEVFLVKQRVTGKLFALKCIKKSPAF
RDSSLENEIAVLKKIKHENIVTLEDIYESTTHYYLVMQLVSGGELFDRILERGVYTEKDA
SLVIQQVLSAVKYLHENGIVHRDLKPENLLYLTPEENSKIMITDFGLSKMEQSGVMSTAC
GTPGYVAPEVLAQKPYSKAVDCWSIGVITYILLCGYPPFYEETESKLFEKIKDGYYEFES
PFWDDISESAKDFICHLLEKDPNERYTCEKALRHPWIAGNTALRRDIYPSVSLQIQKNFA
KSKWRQAFNAAAVVHHMRKLHMNLHSPGVRPEVENRPPVPQASDASRPSSPEITVTEAPA
LDQCVALPALARLPCPHSPRPTAPSGRSLNCLVNGSLRISSSLVPMQHGPLAVGPCGCCS
SCLSVGSKGKSSYCSEPTLLKKANKKQNFKSEVMVPVRASASSHCRAGQTGVCLIM
NT seq 1431 nt   +upstreamnt  +downstreamnt
atgggtcgaaaggaagaagatgactgcagttcttggaagaaacagaccacgaacatccgg
aaaaccttcgtcttcatggaagtgctgggatcaggagctttttcggaagttttcctggtg
aagcaaagggtaacagggaagctctttgccctgaagtgcatcaagaagtcacctgccttt
cgggacagcagcctggagaatgagatcgctgtgttgaaaaagatcaagcatgaaaacatc
gtgaccctggaggacatctatgagagcaccactcactactacctggtcatgcagctcgtc
tctggcggggagctctttgaccggattctggagaggggtgtctacactgagaaggatgcc
agcctggtgatccagcaggtcttgtcggccgtgaaatacctccacgagaatggcatcgtc
cacagagacttaaagcctgaaaacctgctatacctcacccctgaagagaattctaagatc
atgatcacagactttggtctgtccaagatggaacagagtggtgtcatgtccactgcctgt
gggaccccaggctacgtagctccggaagtgttggcccagaaaccctacagcaaggctgtg
gactgctggtccattggcgtcatcacttacatactgctgtgtgggtatccgcctttctat
gaagaaactgagtctaagctttttgagaagatcaaggatggctactatgagtttgagtct
cctttctgggatgacatttctgagtcagccaaggattttatttgccacttgctggagaag
gacccgaatgagcggtacacctgtgagaaggccttgaggcacccctggatcgctggaaac
acagccctccgccgggacatctacccgtcggtcagcctccagatccagaagaactttgcc
aagagcaagtggagacaagccttcaacgcagcagctgtggtgcaccacatgaggaagctg
cacatgaacctgcacagtccgggcgtccgcccggaggtggagaacaggccacctgtcccg
caagcctcagatgcttcaagacccagctcccctgagatcaccgtcaccgaggcgcctgct
ctggaccagtgcgtggcgctccctgccctggcacggctgccctgcccgcacagcccccgg
cccactgcccccagcggccggtccctcaactgcctggtcaacggctccctccgcatcagc
agcagcctggtgcccatgcagcacgggcccctggccgtcgggccctgcggctgctgctcc
agctgcctgagcgtcgggagcaaagggaagtcctcctactgctccgagcccacgctcctc
aaaaaggccaacaaaaaacagaacttcaaatcggaagtcatggtaccagtcagagccagc
gccagctcccactgccgggcagggcagactggagtctgtctcattatgtga

DBGET integrated database retrieval system