KEGG   Rousettus aegyptiacus (Egyptian rousette): 107497279
Entry
107497279         CDS       T06036                                 

Gene name
BECN2
Definition
(RefSeq) beclin-2
  KO
K08334  beclin
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04136  Autophagy - other
ray04137  Mitophagy - animal
ray04140  Autophagy - animal
ray04215  Apoptosis - multiple species
ray04371  Apelin signaling pathway
ray05010  Alzheimer disease
ray05014  Amyotrophic lateral sclerosis
ray05016  Huntington disease
ray05017  Spinocerebellar ataxia
ray05022  Pathways of neurodegeneration - multiple diseases
ray05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107497279 (BECN2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107497279 (BECN2)
   04136 Autophagy - other
    107497279 (BECN2)
   04137 Mitophagy - animal
    107497279 (BECN2)
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    107497279 (BECN2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107497279 (BECN2)
   05014 Amyotrophic lateral sclerosis
    107497279 (BECN2)
   05016 Huntington disease
    107497279 (BECN2)
   05017 Spinocerebellar ataxia
    107497279 (BECN2)
   05022 Pathways of neurodegeneration - multiple diseases
    107497279 (BECN2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    107497279 (BECN2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107497279 (BECN2)
   03029 Mitochondrial biogenesis [BR:ray03029]
    107497279 (BECN2)
Membrane trafficking [BR:ray04131]
 Autophagy
  Autophagosome formation proteins
   PI3K complex
    107497279 (BECN2)
Mitochondrial biogenesis [BR:ray03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    107497279 (BECN2)
SSDB
Motif
Pfam: APG6 APG6_N ALMT PHM7_cyt REC1 Exonuc_VII_L ERM GAS
Other DBs
NCBI-GeneID: 107497279
NCBI-ProteinID: XP_015974431
LinkDB
Position
Unknown
AA seq 432 aa
MSSVRFMCQRCSQPLRPTQSPETLGQEPAALTPASVQGQPGESPEEGLTSRVEINTEKLQ
DGDSCRTLPGEGRMSGYDFNNFTLLGKLGSRRSLNSIQKATRGSFDFLSGQEDLDHPLCE
DCTDDLLEQLDTQLALTESDSQNYRRCLKTKEGISEEVREALQEELKNVELEEARLLREL
EKVEENRERVAAALKEAQVETEMLDQQERQYQRDCSEMKWQQLELNDELRSLDNRLRYAQ
TQLDQLEKTNAFRSTFTIYHDGPLATINNLRLGCLPTVPVSWNEINMAWGQTSLLLLALS
KTIGLEFQRYRLIPCGNRSYLKSLTDDAGELPLFCSKRKNAFFYNKLDQAMMAFLDCMQQ
FKEEAEKGKLGLSMPYRIDVEKGLIEEPGASGGFYSIRTHLNTEEQWTKALKLMLINFKC
SLAWVSLRYFQK
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgtcctctgttcgcttcatgtgccagcgctgcagccagcccctgaggccaactcagtct
ccagagaccttgggccaagaacctgcagctttaacccccgcctcagtgcaggggcagcca
ggagaaagccctgaggaaggccttacctctagggtggagataaatactgaaaagctgcag
gatggtgactcttgcaggaccctccctggcgagggcaggatgtctgggtatgattttaac
aacttcactctgcttgggaagttgggttctcgaagaagtctcaacagcatccagaaggcc
actaggggcagtttcgacttcctttctggtcaagaggatcttgaccaccccctgtgtgag
gactgcactgacgatctgctcgagcagctggacacccaactcgctctcacggaatctgac
agccagaactacagacgctgcctgaagaccaaagagggaataagtgaggaagtgagggag
gcgctgcaagaggagctgaagaacgtggagctggaggaagcgcggctgctccgggagctg
gagaaggtggaggagaaccgagaaagagtggcagcggccctcaaggaagcccaggtagag
actgagatgctggaccagcaggaaaggcagtaccagagagactgcagcgaaatgaagtgg
caacagctggagctgaatgacgagctgaggagcttggataatcggctgcgatacgcccag
acccagctagaccagctggagaaaaccaacgcattcaggtcaacattcacgatctaccat
gacggccccttggccaccatcaataacctccgcttgggctgcctccccactgtccccgtg
agctggaatgagattaacatggcctggggacagacatccctgctgctcctggccctgtct
aaaaccattggactggagtttcagagatatcgactcatcccctgtggaaaccgctcctac
ctgaagtctttaacagatgacgccggggagctgcctttgttctgtagcaagcggaagaat
gctttcttctacaacaagctcgaccaggcgatgatggcttttttggactgcatgcagcag
tttaaggaagaggctgagaaaggcaagttgggtctctccatgccttacaggattgacgtg
gagaaaggcttgatagaggagcctggcgccagtggtgggttctattccattagaacccac
ttgaatacagaggagcagtggacaaaggcgctcaagcttatgcttataaattttaagtgt
agtcttgcttgggtctctttaaggtattttcaaaaatga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513845
Entry
107513845         CDS       T06036                                 

Gene name
BECN1
Definition
(RefSeq) beclin-1
  KO
K08334  beclin
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04136  Autophagy - other
ray04137  Mitophagy - animal
ray04140  Autophagy - animal
ray04215  Apoptosis - multiple species
ray04371  Apelin signaling pathway
ray05010  Alzheimer disease
ray05014  Amyotrophic lateral sclerosis
ray05016  Huntington disease
ray05017  Spinocerebellar ataxia
ray05022  Pathways of neurodegeneration - multiple diseases
ray05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107513845 (BECN1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107513845 (BECN1)
   04136 Autophagy - other
    107513845 (BECN1)
   04137 Mitophagy - animal
    107513845 (BECN1)
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    107513845 (BECN1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107513845 (BECN1)
   05014 Amyotrophic lateral sclerosis
    107513845 (BECN1)
   05016 Huntington disease
    107513845 (BECN1)
   05017 Spinocerebellar ataxia
    107513845 (BECN1)
   05022 Pathways of neurodegeneration - multiple diseases
    107513845 (BECN1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    107513845 (BECN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107513845 (BECN1)
   03029 Mitochondrial biogenesis [BR:ray03029]
    107513845 (BECN1)
Membrane trafficking [BR:ray04131]
 Autophagy
  Autophagosome formation proteins
   PI3K complex
    107513845 (BECN1)
Mitochondrial biogenesis [BR:ray03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    107513845 (BECN1)
SSDB
Motif
Pfam: APG6 APG6_N BH3 MT HAUS-augmin3 Exonuc_VII_L NAPRTase_C ERM FPP Ima1_N GAS Suppressor_APC
Other DBs
NCBI-GeneID: 107513845
NCBI-ProteinID: XP_016006414
LinkDB
Position
Unknown
AA seq 448 aa
MEGSKSSSSTMQVSFVCQRCSQPLKLDTSFKILDHVTIQELTAPLLATAQVKPGETQEEE
ANSGEEPFIETCQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDL
FDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQM
ELKELAFEEERLIQELEDVEKNRKIVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLE
LDDELKSVENQMRYAQMQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEWNE
INAAWGQTVLLLHALANKMGLKFQRYRLVPCGNHSYLESLTDKSKELPLYCSGGLRFFWD
NKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGSSGGSYSIKTQFNSE
EQWTKALKYMLTNLRWGLAWVSSQFYNK
NT seq 1347 nt   +upstreamnt  +downstreamnt
atggaggggtctaagtcgtccagcagcaccatgcaagtgagcttcgtgtgccagcgctgc
agccagcccctgaaactggacacgagcttcaagattctggaccatgtcaccatccaggag
ctcacagctccattacttgccacagcccaggtgaaaccaggagagacccaggaagaagaa
gctaactcaggagaggagccatttattgaaacttgccaggatggtgtctctcgcagattc
atccccccagccaggatgatgtctacagaaagtgccaatagcttcactctgattggggag
gcatctgatggcggcaccatggagaacctcagccgaagactgaaggtcactggggacctt
tttgacatcatgtcaggccagacagatgtggatcacccactgtgtgaggaatgcacagat
actcttttagaccagctggacactcagctcaatgtcactgaaaatgaatgtcagaactac
aaacgctgtttggagatcttagagcagatgaatgaggatgacagtgaacagctacagatg
gagctaaaagagctggcatttgaggaggagaggctgatccaggagctggaagatgtggaa
aagaaccgcaagatcgtagcagaaaatctcgagaaggtccaggccgaggctgagagactg
gatcaggaagaggctcagtatcagagggaatacagtgaatttaaacgacaacagctggaa
ctggatgatgagctgaagagtgtagaaaaccagatgcgttatgcccagatgcagctggac
aagctgaagaaaaccaacgtctttaatgcaaccttccacatttggcatagtggacaattt
ggcacaattaataacttcagactgggtcgcttgcccagtgttcctgtggaatggaatgaa
attaatgctgcctggggccagacagtgttgctgcttcatgctctggccaataagatgggt
ctgaaatttcagaggtatcgacttgttccctgtggaaaccactcctacctggagtctctg
acagacaaatctaaggagctgccgttatactgttctgggggattgcggtttttctgggac
aacaagtttgaccatgcaatggtggctttcctggactgtgtgcagcagttcaaagaagag
gttgagaaaggcgagacacgtttttgtcttccctacaggatggatgtggagaaaggcaag
attgaagacacaggaagcagtggcggctcctattccatcaaaacccagttcaactctgag
gaacagtggacaaaagctctcaagtatatgctgacgaatcttaggtggggtcttgcttgg
gtgtcctcacagttttataacaaatga

DBGET integrated database retrieval system