KEGG   Rousettus aegyptiacus (Egyptian rousette): 107497366
Entry
107497366         CDS       T06036                                 

Gene name
MAD1L1
Definition
(RefSeq) mitotic spindle assembly checkpoint protein MAD1 isoform X1
  KO
K06679  mitotic spindle assembly checkpoint protein MAD1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04110  Cell cycle
ray04114  Oocyte meiosis
ray04914  Progesterone-mediated oocyte maturation
ray05166  Human T-cell leukemia virus 1 infection
ray05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107497366 (MAD1L1)
   04114 Oocyte meiosis
    107497366 (MAD1L1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107497366 (MAD1L1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107497366 (MAD1L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107497366 (MAD1L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ray03036]
    107497366 (MAD1L1)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     107497366 (MAD1L1)
SSDB
Motif
Pfam: MAD DUF4200
Other DBs
NCBI-GeneID: 107497366
NCBI-ProteinID: XP_015974565
LinkDB
Position
Unknown
AA seq 812 aa
MEGLAVTPPLSSSRRDVAMEDLGENTTVLSSLRSLNNFISQRVEGGIGPDVSTSAQGSLQ
MQYQQSMQLEERAEQIRSKSHIIQVEREKMQMELSHKRARVELERAASTSARSYEREVDR
NQELLARIRQLQEREAEAEEKMKEQLERNRLCKQSLDVASRKLREKEDGLAEAGETISEL
KGRISELQWSVMNQEMQVKDLESEKQELQEQLDLQHRKWQEANQKIQELQASQEARADQE
QKVKDLEQKLSLQEQDAVIVRSMKSELVRLPKVEQELKQLREENAYLREMRETNGLLREE
VEGLQRKLGRQEKMQENLVDLELEKERLLAKLQSWERLDQTTGLSIRTPEDLSRFVVELQ
QRELALKDRNSSITSSARELDKVRQQLQEEVRQVSAQLLEERKKRETHEALARRLQKRVL
LLTKERDGMRAILGSYDSELTPAEYSPQLTRRMREAEDMVQKVHAHSSEMEAQLSQALED
LGVQKQRADMAEDRGAGGGAAPPGGRQAAAGGAAAAAQPGGRLRPGPDQSAAHDREPGQR
GPAEPPPGPGPAAGGVRAAAAAAGRPGAGRPGPRRPAGLGAAVVPGGGRAEEAGRERGAE
KPAAQGGLPDQDPGVPEGLLHAHGLPGGHHQGGPVPADVHVRRAQGRLPRLQGRGTVGRH
HAAAGDGLLALRARARAAAPAGQGQHPRLPQRPDPRPLQPPDRGLARGSAHPSPALCPER
PCQDRMGTLGPLCQPGLSPTPSSGPTRLVPSIPEGGLARTWGPCSGPAPCPLQEPRPGCS
ALGAWQVDLWPPHQTLQRNKVPSLATLSAHRV
NT seq 2439 nt   +upstreamnt  +downstreamnt
atggaagggcttgctgtgacccctcccttgtcttcttccagaagggacgtggccatggaa
gaccttggggaaaacaccactgtcctgtcctccctgagatctttgaacaacttcatttct
cagcgagtggagggaggaattggaccggatgtttctacctctgcccagggttctctgcag
atgcagtaccagcagagcatgcagttggaagaacgagcagagcagatccgttcgaagtct
cacatcatccaggtggagcgagagaaaatgcagatggagctgagtcacaagagggctcga
gtcgagctggagcgagcagccagcaccagtgccaggagctatgagcgcgaggtggaccgc
aaccaggagctcctggcacgcattcggcagcttcaggagcgggaggccgaggcggaggag
aagatgaaagagcaactggagcgcaacaggctgtgtaagcagagcctggatgtggccagc
aggaagctgcgggagaaggaggacggcctggccgaggcgggcgagaccatcagtgagtta
aagggcaggatctcagaactgcagtggagtgtgatgaaccaggagatgcaagtgaaggac
ctggagtctgagaagcaagagctgcaggagcagctggacttgcagcacagaaaatggcag
gaagctaatcagaagattcaggagcttcaggccagccaggaagcgagggcggaccaggag
cagaaggtcaaggatttggagcagaagctgtccctgcaggagcaggatgctgtgattgtg
aggagcatgaagtctgagctggtgcggttgcccaaggtggagcaggagctgaagcagctg
agggaggagaatgcctacctgcgggagatgcgcgagaccaacgggctgctcagggaagaa
gtggagggattgcagcggaagctggggcgtcaggagaagatgcaggagaatttggttgac
ctggagctggagaaggagaggctgctggcgaagctgcaaagctgggagagactggaccag
accacgggcttgagcatcaggaccccggaagacctgtccaggtttgtcgttgagctacag
cagcgagaactggccctgaaggacaggaacagctccatcaccagcagtgcccgggagctg
gacaaggtgaggcagcagctccaggaagaggtgcgccaggtcagcgcccagctgctggag
gagaggaagaagcgtgagacacacgaggccctggcccggcggctgcagaagcgcgtcctg
ctgttgacgaaggagcgggacggcatgcgcgccatcctggggtcctacgacagcgagctg
accccggccgagtactcgccccagctcacacggcgcatgcgcgaggccgaggacatggtg
cagaaggtgcacgcccacagctcggagatggaggctcagctgtcacaggcgctggaggac
ctgggagtccagaagcagagagcggacatggctgaagatcgaggagctggagggggagcg
gcgccgcctggagggcgacaagcagcagctggaggcgcagctgcagcagctcagcctggc
gggcgactacgaccagggccggaccaaagtgctgcacatgaccgtgaacccggccagcga
ggcccagcagagcctccgccaggaccaggcccggctgcgggaggagtgcgagcggctgcg
gcagctgctgggcgccctggggcggggcggcccggcccccgccggcctgcaggcctcggg
gctgccgtcgtcccaggaggtggcagagctgaagaagcaggtagagagcgcggagctgaa
aaaccagcggctcaaggaggtcttccagaccaagatccaggagttccggaaggcctgcta
cacgctcacgggctaccaggtggacatcaccagggagggccagtaccggctgacgtccat
gtacgccgagcacaaggacgactgcctcgtcttcaaggccgcgggaccgtcgggcgccac
catgcagctgctggagacggccttctcgcgctccgtgcccgagctcgtgcagctgcacct
gctggccaaggacagcatccccgccttcctcagcgccctgaccctcgacctcttcagccg
ccagaccgtggcctagcccgcggctccgcccatcccagccccgccctctgcccagaaagg
ccatgtcaggacaggatggggacccttggccccctctgccagccggggctgagccccacc
ccgagctcaggccccacccgcctcgtcccctccatcccggaaggcggcctggcgaggacg
tgggggccgtgctctgggcccgctccctgccccctgcaggagccccgcccgggctgctca
gccctaggcgcctggcaggtggacctgtggccaccacaccaaaccctgcaacggaataaa
gttccctccttggccaccctgtctgctcaccgtgtctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107510875
Entry
107510875         CDS       T06036                                 

Gene name
MAD2L1
Definition
(RefSeq) mitotic spindle assembly checkpoint protein MAD2A
  KO
K02537  mitotic spindle assembly checkpoint protein MAD2
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04110  Cell cycle
ray04114  Oocyte meiosis
ray04914  Progesterone-mediated oocyte maturation
ray05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107510875 (MAD2L1)
   04114 Oocyte meiosis
    107510875 (MAD2L1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107510875 (MAD2L1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107510875 (MAD2L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ray03036]
    107510875 (MAD2L1)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     107510875 (MAD2L1)
SSDB
Motif
Pfam: HORMA ATG101 bacHORMA_2
Other DBs
NCBI-GeneID: 107510875
NCBI-ProteinID: XP_016000300
LinkDB
Position
Unknown
AA seq 205 aa
MALQLSREQGITLRGSAEIVAEFFSFGINSILYQRGVYPSETFTRVQKYGLTLLVTTDPE
LMKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSTPREKS
QKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEQ
VRLRSFTTTIHKVNSLVAYKIPVND
NT seq 618 nt   +upstreamnt  +downstreamnt
atggcgctgcagctctcccgggagcaaggcatcaccctgcgcgggagcgccgaaatcgtg
gccgagttcttctcatttggcatcaacagcattttatatcagcgtggcgtatatccatct
gaaacctttactcgagtgcagaaatatggactcaccttgcttgtaactactgatcctgag
ctcatgaaatatctgaataatgtggtggaacaactaaaagattggttatacaagtgttca
gttcagaaactggtggtagtcatctcaaacattgaaagtggcgaggtcttggaaagatgg
caatttgacattgagtgtgacaagactgccaaggatgatagcacacccagagaaaagtct
cagaaggctatccaagatgaaatccgctcagtgatcagacagatcacagctactgtcaca
ttcctgccactgctggaagtgtcctgttcatttgatctactgatatatacagacaaggat
ttggttgtacctgaaaaatgggaagagtcgggaccacagttcattaccaattctgagcaa
gtccgtcttcgttccttcactactacaatccacaaagtaaatagcttggtagcctacaaa
atccctgtcaatgactga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513121
Entry
107513121         CDS       T06036                                 

Definition
(RefSeq) mitotic spindle assembly checkpoint protein MAD2B
  KO
K13728  mitotic spindle assembly checkpoint protein MAD2B
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04110  Cell cycle
ray04114  Oocyte meiosis
ray04914  Progesterone-mediated oocyte maturation
ray05100  Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107513121
   04114 Oocyte meiosis
    107513121
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107513121
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    107513121
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ray03036]
    107513121
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     107513121
SSDB
Motif
Pfam: HORMA
Other DBs
NCBI-GeneID: 107513121
NCBI-ProteinID: XP_016004896
LinkDB
Position
Unknown
AA seq 211 aa
MTTLTRQDLNFGQVVADVLCEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPEL
NQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSISSDSLLSHVE
QLLRAFILKISVCDAVLDHNPPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQDVH
MHDPRLIPLKTMTSDILKMQLYVEERAHKSS
NT seq 636 nt   +upstreamnt  +downstreamnt
atgaccacgctcacaagacaggacctcaactttggccaagtggtggccgatgtcctctgc
gaattcctggaggtggctgtgcacctaatcctctacgtgcgtgaggtctaccccgtgggc
atcttccagaagcgtaagaagtacaatgtgcctgtccagatgtcctgtcacccggagctg
aaccagtatatccaggacacgctgcactgtgtcaagccactcctggagaagaatgatgtg
gagaaagtggtggtggtaattttggacaaagagcaccgcccagtggaaaaatttgtcttt
gaaatcacccagcccccgctgctgtccatcagctcagactccttgctgtctcatgtggaa
cagctgctccgagccttcatcctgaagatcagtgtctgtgatgctgtcctggaccacaac
cccccaggctgtaccttcacagtcttggtgcacacgagggaagctgccactcgaaacatg
gagaagatccaggtcatcaaggacttcccctggatcctggccgatgagcaggatgtccac
atgcatgacccccggctgatacccctaaaaaccatgacatcagacatattaaagatgcag
ctctacgtggaagaacgagctcataaaagcagctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513122
Entry
107513122         CDS       T06036                                 

Definition
(RefSeq) mitotic spindle assembly checkpoint protein MAD2B-like
  KO
K13728  mitotic spindle assembly checkpoint protein MAD2B
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04110  Cell cycle
ray04114  Oocyte meiosis
ray04914  Progesterone-mediated oocyte maturation
ray05100  Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107513122
   04114 Oocyte meiosis
    107513122
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107513122
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    107513122
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ray03036]
    107513122
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     107513122
SSDB
Motif
Pfam: HORMA DUF5071
Other DBs
NCBI-GeneID: 107513122
NCBI-ProteinID: XP_016004900
LinkDB
Position
Unknown
AA seq 129 aa
MTTLTRQDLNFGQVVADVLCEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPEL
NQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSIRTSPGSWPMS
RMSTCMTPG
NT seq 390 nt   +upstreamnt  +downstreamnt
atgaccacgcttacaagacaggacctcaactttggccaagtggtggccgatgtcctctgc
gaattcctggaggtggctgtgcacctaatcctctacgtgcgtgaggtctacccggtgggc
atcttccagaagcgtaagaagtacaatgtgcctgtccagatgtcctgtcacccggagctg
aaccagtatatccaggacacgctgcactgtgtcaagccactcctggagaagaatgatgtg
gagaaagtggtggtggtaattttggacaaagagcaccgcccagtggaaaaatttgtcttt
gaaatcacccagcccccgctgctgtccatcaggacttcccctggatcctggccgatgagc
aggatgtccacatgcatgacccccggctga

DBGET integrated database retrieval system