KEGG   Rousettus aegyptiacus (Egyptian rousette): 107497376
Entry
107497376         CDS       T06036                                 

Gene name
GPER1
Definition
(RefSeq) G-protein coupled estrogen receptor 1
  KO
K04246  G-protein coupled estrogen receptor 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01522  Endocrine resistance
ray04915  Estrogen signaling pathway
ray04929  GnRH secretion
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    107497376 (GPER1)
   04915 Estrogen signaling pathway
    107497376 (GPER1)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107497376 (GPER1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ray04030]
    107497376 (GPER1)
G protein-coupled receptors [BR:ray04030]
 Rhodopsin family
  Others
   Estrogen
    107497376 (GPER1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx ASL_C2 Abhydrolase_9_N
Other DBs
NCBI-GeneID: 107497376
NCBI-ProteinID: XP_015974579
LinkDB
Position
Unknown
AA seq 350 aa
METSLGTHNGTPAELRLPQALANHTEQQHYALGLFLSCVYTVFLFPIGFVGNILILVVNI
SFRDKMAIPDLYFINLAAADLILVADSLVEVFNLHEQYYDVTALCTFMSLFLQVNMYSSV
FFLTWMSFDRYLALARAVRCGPFRTKQHARLSCGLIWMASVSATLLPFTAAHLQHAGDVC
FCFADVREIQWLEVTLGFIIPFAVIGLCYSLTVRALARAHRHRVLRPRRQKALRMILAVV
LVFFVCWLPENVFISVQLLQRPPPGAAPCQQSFRHAHPLVGHIVNLAAFSNSCLNPLIYS
FLGETFRDKLRLYIERKTHASALNRLCHATLKAALPDSSAQSEVRLSRVA
NT seq 1053 nt   +upstreamnt  +downstreamnt
atggagacgagcctcggcacccacaacggcacccccgcggagctccgcctgccgcaggcg
ctggccaaccacacggagcagcagcactacgccctgggcctcttcctgtcctgcgtctac
accgtcttcctcttccccatcggcttcgtgggcaacatcctgatcctggtggtgaacatc
agcttccgggacaagatggccatccccgacctgtacttcatcaacctggcggcggccgac
ctcatcctggtggccgactccctggtggaggtgttcaacctgcacgagcagtactacgac
gtgaccgcgctctgcaccttcatgtccctcttcctgcaggtcaacatgtacagcagcgtc
ttcttcctcacgtggatgagcttcgaccgctacctggcgctggcccgggcggtgcgctgc
ggcccgttccgcacgaagcagcacgcccggctgagctgcggcctcatctggatggcctcg
gtctccgccacgctgctgcccttcaccgccgcgcacctgcagcacgccggcgatgtgtgc
ttctgcttcgccgacgtcagggagatccagtggctggaggtcaccctgggcttcatcatc
cccttcgccgtcatcggcctctgctactcgctcaccgtgcgggcgctggccagggcgcac
cggcaccgcgtgctgcgcccgcgcaggcagaaggcgctgcgcatgatcctggccgtggtg
ctggtcttcttcgtctgctggctgccggagaacgtcttcatcagcgtccagctcctgcag
cgcccgccgccgggggccgcgccctgccagcagtctttccgccacgcgcaccccctcgtg
ggccacatcgtgaacctcgcggccttctccaacagctgcctgaaccccctcatctacagc
ttcctcggggagaccttcagggacaaactgcggctgtacatcgagcggaagacacatgcg
tcggctctgaaccgcctctgccacgccaccctgaaggcagccctcccagacagctcggcg
cagtcagaggtgaggctcagccgcgtggcgtag

DBGET integrated database retrieval system