KEGG   Rousettus aegyptiacus (Egyptian rousette): 107497394
Entry
107497394         CDS       T06036                                 

Gene name
PDGFA
Definition
(RefSeq) platelet-derived growth factor subunit A isoform X1
  KO
K04359  platelet-derived growth factor subunit A
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04020  Calcium signaling pathway
ray04072  Phospholipase D signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04510  Focal adhesion
ray04540  Gap junction
ray04630  JAK-STAT signaling pathway
ray04810  Regulation of actin cytoskeleton
ray05200  Pathways in cancer
ray05202  Transcriptional misregulation in cancer
ray05206  MicroRNAs in cancer
ray05214  Glioma
ray05215  Prostate cancer
ray05218  Melanoma
ray05231  Choline metabolism in cancer
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107497394 (PDGFA)
   04014 Ras signaling pathway
    107497394 (PDGFA)
   04015 Rap1 signaling pathway
    107497394 (PDGFA)
   04630 JAK-STAT signaling pathway
    107497394 (PDGFA)
   04020 Calcium signaling pathway
    107497394 (PDGFA)
   04072 Phospholipase D signaling pathway
    107497394 (PDGFA)
   04151 PI3K-Akt signaling pathway
    107497394 (PDGFA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107497394 (PDGFA)
   04540 Gap junction
    107497394 (PDGFA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107497394 (PDGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107497394 (PDGFA)
   05202 Transcriptional misregulation in cancer
    107497394 (PDGFA)
   05206 MicroRNAs in cancer
    107497394 (PDGFA)
   05231 Choline metabolism in cancer
    107497394 (PDGFA)
  09162 Cancer: specific types
   05214 Glioma
    107497394 (PDGFA)
   05218 Melanoma
    107497394 (PDGFA)
   05215 Prostate cancer
    107497394 (PDGFA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107497394 (PDGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107497394 (PDGFA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107497394 (PDGFA)
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107497394 (PDGFA)
Cytokines and growth factors [BR:ray04052]
 Growth factors
  Growth factors (RTK binding)
   107497394 (PDGFA)
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   107497394 (PDGFA)
SSDB
Motif
Pfam: PDGF_N PDGF
Other DBs
NCBI-GeneID: 107497394
NCBI-ProteinID: XP_015974628
LinkDB
Position
Unknown
AA seq 211 aa
MRTWACLLLLGCGYLAHALAEEAEIPREVIERLAHSQIHSIRDLQRLLEIDSVGAEDALG
SSPRAHGGRASKHTPEKRLGPVRRKRSIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIW
PPCVEVRRCTGCCTTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECTCA
AGSPSPDHREEETGRRREAGKKRKRKRLKPT
NT seq 636 nt   +upstreamnt  +downstreamnt
atgaggacctgggcttgcctgctgctgctcggctgcggatacctcgcccatgccctggcc
gaggaagccgagatcccccgcgaggtaattgagaggctggcgcacagtcagatccatagc
atccgggacctccagcgactcctggagatagactccgtaggggccgaggacgctctggga
agcagcccgagagcccacggcggccgcgccagcaagcacacacccgagaagcggctcggg
cccgttcggaggaagagaagcatcgaggaggccgtccccgccgtctgcaagaccaggacg
gtcatctacgagatacctcggagccaggtcgaccccacgtcggccaacttcctgatctgg
cccccgtgcgtggaggtgagacgctgcaccggctgctgcaccaccagcagcgtcaagtgc
cagccctcacgcgtgcaccaccggagcgtcaaggtggccaaggtggagtacgtcaggaag
aagccaaagttaaaagaggtgcaggtgaggctggaggagcacctggagtgcacgtgcgcg
gccggcagcccgagcccggaccaccgcgaggaggagacgggaaggcgtagggaggcaggt
aaaaagcggaaaaggaaaaggttaaagcccacctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107497786
Entry
107497786         CDS       T06036                                 

Gene name
FGF8
Definition
(RefSeq) fibroblast growth factor 8 isoform X1
  KO
K04358  fibroblast growth factor
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04020  Calcium signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04810  Regulation of actin cytoskeleton
ray05200  Pathways in cancer
ray05218  Melanoma
ray05224  Breast cancer
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107497786 (FGF8)
   04014 Ras signaling pathway
    107497786 (FGF8)
   04015 Rap1 signaling pathway
    107497786 (FGF8)
   04020 Calcium signaling pathway
    107497786 (FGF8)
   04151 PI3K-Akt signaling pathway
    107497786 (FGF8)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107497786 (FGF8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107497786 (FGF8)
  09162 Cancer: specific types
   05226 Gastric cancer
    107497786 (FGF8)
   05218 Melanoma
    107497786 (FGF8)
   05224 Breast cancer
    107497786 (FGF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107497786 (FGF8)
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107497786 (FGF8)
Cytokines and growth factors [BR:ray04052]
 Growth factors
  Growth factors (RTK binding)
   107497786 (FGF8)
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   107497786 (FGF8)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 107497786
NCBI-ProteinID: XP_015975515
LinkDB
Position
Unknown
AA seq 244 aa
MGSPRSALSCLLLHLLVLCLQAQEGPGGGPALGRELASLFRAGRESQGVSQQVTVQSSPN
FTQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETD
TFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYM
AFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWA
PEPR
NT seq 735 nt   +upstreamnt  +downstreamnt
atgggcagcccccgctcggccctgagctgcctgctgttgcacttgctggttctctgcctc
caagcccaggaaggcccgggcggggggcctgcgctgggcagggagctggcttccctgttc
cgagctggccgcgagtcccagggtgtttcccaacaggtaactgttcagtcctcacctaat
tttacacagcatgtgagggagcagagcctggtgacggatcagctcagccgccgcctcatc
cggacctaccagctctacagccgcaccagcgggaagcacgtgcaggtcctggccaacaag
cgcatcaacgccatggcagaagacggggatcccttcgcaaagctcattgtggagacagat
acctttgggagccgggttcgagtccgaggagctgagacgggcctctacatctgcatgaac
aagaaggggaagttgattgccaagagcaacggcaaaggcaaggattgtgttttcacggag
atcgtcctggagaacaactacacggccctgcagaacgccaagtacgagggctggtacatg
gccttcacccgcaagggccggccccgcaagggctccaagacgcggcagcaccagcgcgag
gtccacttcatgaagcggctgccgcgcggccaccacaccaccgagcagagcctgcgcttc
gagtttctcaactacccgcccttcacgcgcagcttgcgcggcagccagaggacttgggcc
ccggagccccgatag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107498854
Entry
107498854         CDS       T06036                                 

Gene name
FGF21
Definition
(RefSeq) fibroblast growth factor 21
  KO
K22429  fibroblast growth factor 21
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04020  Calcium signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04714  Thermogenesis
ray04810  Regulation of actin cytoskeleton
ray05200  Pathways in cancer
ray05218  Melanoma
ray05224  Breast cancer
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107498854 (FGF21)
   04014 Ras signaling pathway
    107498854 (FGF21)
   04015 Rap1 signaling pathway
    107498854 (FGF21)
   04020 Calcium signaling pathway
    107498854 (FGF21)
   04151 PI3K-Akt signaling pathway
    107498854 (FGF21)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107498854 (FGF21)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    107498854 (FGF21)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107498854 (FGF21)
  09162 Cancer: specific types
   05226 Gastric cancer
    107498854 (FGF21)
   05218 Melanoma
    107498854 (FGF21)
   05224 Breast cancer
    107498854 (FGF21)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107498854 (FGF21)
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107498854 (FGF21)
Cytokines and growth factors [BR:ray04052]
 Growth factors
  Growth factors (RTK binding)
   107498854 (FGF21)
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   107498854 (FGF21)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 107498854
NCBI-ProteinID: XP_015977928
LinkDB
Position
Unknown
AA seq 208 aa
MGWAKARFQHPGLWGPVLAILLGACQAHPVPDSSPLFQFGSQVRQRYLYTDDAQDTEAHL
EIRADGTVAGAARWSPESLLELKALKPGVIQILGVKTSRFLCQRPDGTLYGSLHFDPAAC
SFRELLLADGYNVYQSEALALPLRLPPHGARSSDPAHRGPARFLPLPGPPPEPPQPPGHL
ALEPPDVGSSDPLSMVWPSRGRSPSYTS
NT seq 627 nt   +upstreamnt  +downstreamnt
atgggatgggccaaggccaggttccagcacccaggactgtggggccctgtgctggccatc
ctgctgggggcctgccaggcacaccccgtcccggactccagccctctcttccagtttggg
agtcaagtccggcagcgctacctctacacagatgatgcccaggacacggaggcccacttg
gagatcagggctgatggcacggtggcaggggctgctcgctggagccccgaaagtctcttg
gagctcaaggccctgaagccaggtgtaattcaaatcttgggagtcaagacgtccaggttc
ctgtgccagaggccagatgggacgctgtacggatcgctgcacttcgaccccgcagcctgc
agcttccgggagctgctgctcgcggatgggtacaacgtctaccagtccgaggccctggca
ctcccgcttcgcctgcccccccacggcgcccggtcctcggacccggcccaccgaggaccg
gcacgcttcctgccactgccgggcccgcccccagagcccccgcagcctccagggcacctg
gcccttgagcctcccgacgtgggctcctcggaccccctgagcatggtgtggccttcccgg
ggccgaagccccagctacacttcgtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107500865
Entry
107500865         CDS       T06036                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04020  Calcium signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04390  Hippo signaling pathway
ray04810  Regulation of actin cytoskeleton
ray05200  Pathways in cancer
ray05218  Melanoma
ray05224  Breast cancer
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107500865 (FGF1)
   04014 Ras signaling pathway
    107500865 (FGF1)
   04015 Rap1 signaling pathway
    107500865 (FGF1)
   04390 Hippo signaling pathway
    107500865 (FGF1)
   04020 Calcium signaling pathway
    107500865 (FGF1)
   04151 PI3K-Akt signaling pathway
    107500865 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107500865 (FGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107500865 (FGF1)
  09162 Cancer: specific types
   05226 Gastric cancer
    107500865 (FGF1)
   05218 Melanoma
    107500865 (FGF1)
   05224 Breast cancer
    107500865 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107500865 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107500865 (FGF1)
Cytokines and growth factors [BR:ray04052]
 Growth factors
  Growth factors (RTK binding)
   107500865 (FGF1)
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   107500865 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 107500865
NCBI-ProteinID: XP_015982024
LinkDB
Position
Unknown
AA seq 155 aa
MVDGKKSQGTNTTPFDGYKRRPERPSTILDMSDLGHKGVEEDERCLFTFAHVIFISVQLQ
LSAESVGEVYIKSTESGQYLAMDSDGLLYGSQTPDEDCLFLERLEENHYNTYTSKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggtagatgggaagaagtctcaggggactaacaccactccattcgatggctacaaaagg
agacctgaacgaccatccaccatcttggacatgtctgaccttggacacaagggagtcgaa
gaagatgagagatgtttatttacttttgctcatgttatttttatttcagttcagctgcag
ctcagtgcggaaagtgtgggggaggtgtatataaagagcaccgagagtggccagtacttg
gccatggactccgacgggcttttgtacggctcacagacaccagatgaggactgcttgttc
ctagaaaggctggaggaaaaccattacaacacctacacatccaagaagcacgcagaaaag
aattggtttgttgggctcaagaagaatgggagctgcaagcggggtcctcggactcactac
ggccagaaagcaatcctgtttctccccctgccagtgtcctctgactaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107500922
Entry
107500922         CDS       T06036                                 

Gene name
FGF22
Definition
(RefSeq) fibroblast growth factor 22 isoform X1
  KO
K04358  fibroblast growth factor
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04020  Calcium signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04810  Regulation of actin cytoskeleton
ray05200  Pathways in cancer
ray05218  Melanoma
ray05224  Breast cancer
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107500922 (FGF22)
   04014 Ras signaling pathway
    107500922 (FGF22)
   04015 Rap1 signaling pathway
    107500922 (FGF22)
   04020 Calcium signaling pathway
    107500922 (FGF22)
   04151 PI3K-Akt signaling pathway
    107500922 (FGF22)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107500922 (FGF22)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107500922 (FGF22)
  09162 Cancer: specific types
   05226 Gastric cancer
    107500922 (FGF22)
   05218 Melanoma
    107500922 (FGF22)
   05224 Breast cancer
    107500922 (FGF22)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107500922 (FGF22)
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107500922 (FGF22)
Cytokines and growth factors [BR:ray04052]
 Growth factors
  Growth factors (RTK binding)
   107500922 (FGF22)
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   107500922 (FGF22)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 107500922
NCBI-ProteinID: XP_015982130
LinkDB
Position
Unknown
AA seq 170 aa
MCGRLWLGLAWLLLARAPGAAGSPSSPRRPRSYPHLEGDVRWRRLFSSTHFFLRVDPSGR
VQGTRWRHSPDSVIEIRSIRVGVVALKAVHTGFFVAMSRRGHLYGSRVYSGHCRFRERIE
EDGYNTYASLRGRHRGRPMFLALDGRGAPRRGGRTRRHHLSTHFLPILVS
NT seq 513 nt   +upstreamnt  +downstreamnt
atgtgcggccgcctgtggctgggcctggcgtggctgctgctggcacgggcgcccggcgcc
gcggggtccccaagcagcccccggagaccgcgcagctacccacacctggagggcgatgtg
cgctggcgacgcctcttctcctccacccacttctttctgcgcgtggaccccagcggccgc
gtgcagggcacccgctggcgccacagccctgacagcgtcattgagatccgctccatccga
gtgggggtcgtggccctgaaggctgtgcacaccggcttctttgtggccatgagccgcagg
ggccacctctacgggtcgcgggtctacagcggccactgcaggttccgggagcgcatcgag
gaggacggctacaacacctacgcctcgctgcgcgggcgccaccgcggccggcccatgttc
ctggcactggacgggcgaggagccccacggcgcggtggccggacgcggcggcaccacctg
tccacccacttcctgcccatcctggtctcctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107501166
Entry
107501166         CDS       T06036                                 

Gene name
IGF1
Definition
(RefSeq) insulin-like growth factor I isoform X1
  KO
K05459  insulin-like growth factor 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray01522  Endocrine resistance
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04066  HIF-1 signaling pathway
ray04068  FoxO signaling pathway
ray04114  Oocyte meiosis
ray04115  p53 signaling pathway
ray04150  mTOR signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04152  AMPK signaling pathway
ray04211  Longevity regulating pathway
ray04213  Longevity regulating pathway - multiple species
ray04510  Focal adhesion
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04730  Long-term depression
ray04750  Inflammatory mediator regulation of TRP channels
ray04913  Ovarian steroidogenesis
ray04914  Progesterone-mediated oocyte maturation
ray04935  Growth hormone synthesis, secretion and action
ray04960  Aldosterone-regulated sodium reabsorption
ray05200  Pathways in cancer
ray05202  Transcriptional misregulation in cancer
ray05205  Proteoglycans in cancer
ray05214  Glioma
ray05215  Prostate cancer
ray05218  Melanoma
ray05224  Breast cancer
ray05410  Hypertrophic cardiomyopathy
ray05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107501166 (IGF1)
   04014 Ras signaling pathway
    107501166 (IGF1)
   04015 Rap1 signaling pathway
    107501166 (IGF1)
   04066 HIF-1 signaling pathway
    107501166 (IGF1)
   04068 FoxO signaling pathway
    107501166 (IGF1)
   04151 PI3K-Akt signaling pathway
    107501166 (IGF1)
   04152 AMPK signaling pathway
    107501166 (IGF1)
   04150 mTOR signaling pathway
    107501166 (IGF1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107501166 (IGF1)
   04115 p53 signaling pathway
    107501166 (IGF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107501166 (IGF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    107501166 (IGF1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    107501166 (IGF1)
   04914 Progesterone-mediated oocyte maturation
    107501166 (IGF1)
   04935 Growth hormone synthesis, secretion and action
    107501166 (IGF1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    107501166 (IGF1)
  09156 Nervous system
   04730 Long-term depression
    107501166 (IGF1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107501166 (IGF1)
  09149 Aging
   04211 Longevity regulating pathway
    107501166 (IGF1)
   04213 Longevity regulating pathway - multiple species
    107501166 (IGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107501166 (IGF1)
   05202 Transcriptional misregulation in cancer
    107501166 (IGF1)
   05205 Proteoglycans in cancer
    107501166 (IGF1)
  09162 Cancer: specific types
   05214 Glioma
    107501166 (IGF1)
   05218 Melanoma
    107501166 (IGF1)
   05215 Prostate cancer
    107501166 (IGF1)
   05224 Breast cancer
    107501166 (IGF1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107501166 (IGF1)
   05414 Dilated cardiomyopathy
    107501166 (IGF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107501166 (IGF1)
   01522 Endocrine resistance
    107501166 (IGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107501166 (IGF1)
Cytokines and growth factors [BR:ray04052]
 Growth factors
  Growth factors (RTK binding)
   107501166 (IGF1)
SSDB
Motif
Pfam: Insulin DUF2865
Other DBs
NCBI-GeneID: 107501166
NCBI-ProteinID: XP_015982541
LinkDB
Position
Unknown
AA seq 169 aa
MGKISSLPTQLFKCCFCDFLKVKMHIMSSSHVFYLALCLLTFTSSATAGPETLCGAELVD
ALQFVCGDRGFYFNKPMGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARS
VRAQRHTDMPKAQKYQPPSTNKKTKSQRKKEVHLKNASRGSAGNKNYRM
NT seq 510 nt   +upstreamnt  +downstreamnt
atgggaaaaatcagcagtcttccaacccaattatttaagtgctgcttttgtgatttcttg
aaggtgaagatgcacatcatgtcctcctcgcacgtcttctacctggccttgtgcttgctc
accttcaccagctccgccacggctggaccggagacactctgtggggctgagctggtggac
gctcttcagttcgtgtgtggagacaggggcttttatttcaacaagcccatgggatatggc
tccagcagccggagggcacctcagacaggcattgtggatgagtgctgcttccggagctgt
gacctgaggaggctggagatgtactgcgcgccccttaagcctgccaagtcggcccgctcc
gtccgtgcccagcgccacaccgacatgcccaaggctcagaagtatcagcccccatctacc
aacaagaaaacgaagtctcagaggaaaaaggaagtacatttgaagaatgcaagtagaggg
agtgcgggaaataagaactacagaatgtag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107501285
Entry
107501285         CDS       T06036                                 

Gene name
HGF
Definition
(RefSeq) hepatocyte growth factor isoform X1
  KO
K05460  hepatocyte growth factor
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04020  Calcium signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04510  Focal adhesion
ray05144  Malaria
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05211  Renal cell carcinoma
ray05218  Melanoma
ray05223  Non-small cell lung cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107501285 (HGF)
   04014 Ras signaling pathway
    107501285 (HGF)
   04015 Rap1 signaling pathway
    107501285 (HGF)
   04020 Calcium signaling pathway
    107501285 (HGF)
   04151 PI3K-Akt signaling pathway
    107501285 (HGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107501285 (HGF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107501285 (HGF)
   05205 Proteoglycans in cancer
    107501285 (HGF)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107501285 (HGF)
   05226 Gastric cancer
    107501285 (HGF)
   05218 Melanoma
    107501285 (HGF)
   05211 Renal cell carcinoma
    107501285 (HGF)
   05223 Non-small cell lung cancer
    107501285 (HGF)
  09174 Infectious disease: parasitic
   05144 Malaria
    107501285 (HGF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107501285 (HGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107501285 (HGF)
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107501285 (HGF)
Cytokines and growth factors [BR:ray04052]
 Growth factors
  Growth factors (RTK binding)
   107501285 (HGF)
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   107501285 (HGF)
SSDB
Motif
Pfam: Kringle Trypsin PAN_1 DUF316 DUF1986
Other DBs
NCBI-GeneID: 107501285
NCBI-ProteinID: XP_015982763
LinkDB
Position
Unknown
AA seq 730 aa
MWVTKLLPVLLLQQVLLHLLLLPIAIPYAGGQKKRRNTLHEFKKSAKTTLFKEDPLLKIK
TKKMNTADQCANRCIRNKGLPFTCKAFVFDKARKRCLWFPFNSMSSGVKKEFGHEFDLYE
NKDYIRNCIIGKGGSYKGTVSITKSGIKCQPWNSMIPHEHSFLPSSYRGKDLQENYCRNP
RGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGPMDHTESGKICQRWDQQTP
HRHKFLPERYPDKGFDDNYCRNPDGKPRPWCYTLDPDTPWEYCAIKMCAHSAVNDSDVPM
ETTECIQGQGEGYRGTINTIWNGIPCQRWDSQYPHQHDITPENFKCKDLRENYCRNPDGA
ESPWCFTTDPNIRVGYCSQIPKCDVSSGQDCYRGNGKNYMGNLSKTRSGLTCSMWDKNME
DLHRHIFWEPDASKLNKNYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNL
DHPVISCAKTKQLRVVNGIPTRTNVGWMVSLKHRNKHICGGSLIKESWILTARQCFPSRN
KDLKDYEAWLGIHDVHGRGDEKRRQVLNVSQLVYGPEGSDLVLLKLARPAVLDDFVSTID
LPNYGCTIPEKTTCSVYGWGYTGLINSDGLLRVAHLYIMGNEKCSQYHQGKVTLNESEIC
AGAENIVTGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHK
IILTYKVPQS
NT seq 2193 nt   +upstreamnt  +downstreamnt
atgtgggtgaccaaacttctgccagtcctgctgctgcagcaggtcctcctacatctcctg
ctgcttcccatcgccatcccctatgcaggaggacagaagaaaagaagaaacacacttcat
gaatttaaaaagtcagcaaagactactctatttaaagaagatccattactgaagataaaa
acgaaaaaaatgaacacagcggaccaatgtgccaatagatgtattaggaataaaggactt
ccattcacttgcaaggcctttgtttttgataaagcaagaaaacgatgcctctggttccct
ttcaatagcatgtcaagtggggtgaaaaaagaatttggccatgaattcgacctgtatgaa
aacaaagactacattagaaactgcatcattggtaaaggaggtagctacaagggaacggta
tctataactaagagtggcatcaaatgccagccctggaattccatgatcccacatgaacac
agctttttgccttcgagctatcggggtaaagacctacaggaaaactactgtcgaaatcct
cgaggggaagaagggggaccttggtgtttcacaagcaatccagaggtacgctacgaagtc
tgtgacattcctcagtgttcagaagttgaatgcatgacctgcaatggggaaagttatcga
ggtcccatggatcatacagaatcaggcaagatttgtcagcgctgggatcagcagacgccg
catcggcacaagttcttgccagaaagatatcccgacaagggctttgatgataattattgc
cgcaatcctgatggcaagccgaggccatggtgctatactcttgaccctgacaccccgtgg
gagtactgtgcaattaaaatgtgtgctcacagtgccgtgaatgactcagatgtccctatg
gaaacaactgaatgcatacaaggtcaaggcgaaggttaccgaggcactatcaataccatt
tggaatggaattccatgtcagcgatgggattcccaataccctcatcaacatgacataact
cctgaaaatttcaagtgcaaggacctaagagaaaattattgccggaatccagatggggct
gagtcaccctggtgttttaccactgatccaaacatccgagttggctactgctcccaaatt
ccaaaatgtgacgtgtcaagtggacaagattgttatcgtggaaatggcaaaaattatatg
ggtaatttatcaaaaacacgatctggactaacatgttcaatgtgggataagaacatggaa
gacttacaccggcacatcttctgggaaccagatgctagtaagttgaataagaattactgc
cggaatcctgacgatgatgcccatggtccctggtgttacacagggaaccctctcattcct
tgggattactgtcccatttctcgttgtgaaggtgataccacacctacaatagtcaattta
gaccatcctgtaatatcttgcgccaaaacaaaacaattgcgagttgtaaatggaattcca
acacgaacaaatgtaggatggatggttagtttgaaacacagaaataaacatatctgcgga
ggatcattgataaaggaaagttggattcttactgcaagacagtgtttcccttctcgaaac
aaagacttgaaagattacgaagcctggcttggaatccatgatgtccatggaagaggagat
gagaagcgcagacaggttctaaatgtttctcagctggtatatgggcctgaaggatcagat
ctggtactactgaagcttgctagacctgctgtcctggatgattttgttagtacaattgat
ttacctaattatggatgcacaattcctgaaaaaaccacttgcagtgtttatggctggggc
tacactggattgatcaactctgatggtctattaagagtagcacatctctatattatgggg
aatgagaaatgcagccaatatcatcaagggaaggtgactctgaatgagtctgaaatatgt
gctggagctgaaaatattgtaacaggaccgtgcgagggagactatggtggcccacttgtt
tgtgaacagcataaaatgagaatggttcttggtgtcattgttcctggtcgtggatgtgcc
attccaaatcgtcctggtatttttgtccgagtagcatattatgcaaaatggatacacaaa
attatattaacatataaggtaccacagtcatag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107501960
Entry
107501960         CDS       T06036                                 

Gene name
FGF7
Definition
(RefSeq) LOW QUALITY PROTEIN: fibroblast growth factor 7
  KO
K04358  fibroblast growth factor
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04020  Calcium signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04810  Regulation of actin cytoskeleton
ray05200  Pathways in cancer
ray05218  Melanoma
ray05224  Breast cancer
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107501960 (FGF7)
   04014 Ras signaling pathway
    107501960 (FGF7)
   04015 Rap1 signaling pathway
    107501960 (FGF7)
   04020 Calcium signaling pathway
    107501960 (FGF7)
   04151 PI3K-Akt signaling pathway
    107501960 (FGF7)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107501960 (FGF7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107501960 (FGF7)
  09162 Cancer: specific types
   05226 Gastric cancer
    107501960 (FGF7)
   05218 Melanoma
    107501960 (FGF7)
   05224 Breast cancer
    107501960 (FGF7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107501960 (FGF7)
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107501960 (FGF7)
Cytokines and growth factors [BR:ray04052]
 Growth factors
  Growth factors (RTK binding)
   107501960 (FGF7)
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   107501960 (FGF7)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 107501960
NCBI-ProteinID: XP_015984097
LinkDB
Position
Unknown
AA seq 188 aa
MRKWILTWILPTLLYSSCFHIICLVGTISLACNDMTPEQMAANVKXVRSYDYMEGGDIRV
RRLFCRTQWYLRIDKRGKVKGTQEMKNNFNIMEIRTVEVGIVAIKGVESEYFLAMNKEGK
LYAKKECNEDCNFKELILENHYNTYASAKWTHSGREMFVALNQKGAPVKGKKTKKEQKTA
HFLPMAIT
NT seq 567 nt   +upstreamnt  +downstreamnt
atgcgcaaatggatactgacatggatcctgccaactttgctctacagttcatgctttcac
attatctgtctagtgggcactatatctttagcttgcaatgacatgactccagagcaaatg
gctgcaaatgtgaaannagtaagaagttatgattacatggaaggaggggatataagagtg
agaaggctcttctgtcgaacacagtggtatctgagaattgataaacgaggcaaagtcaaa
gggactcaagagatgaagaacaatttcaatatcatggaaatcaggacagtggaggttgga
attgtggcaatcaaaggggtggaaagtgaatattttcttgcaatgaacaaagaaggaaaa
ctctatgcaaagaaagaatgcaatgaagattgcaacttcaaagaattaattctggaaaac
cattacaacacttatgcatcagctaaatggacacacagtggaagagaaatgtttgttgcc
ttaaatcagaagggcgctcctgtaaaagggaaaaaaacgaagaaagaacaaaaaacagct
cactttcttcctatggcaataacctaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107502078
Entry
107502078         CDS       T06036                                 

Gene name
PDGFB
Definition
(RefSeq) platelet-derived growth factor subunit B isoform X1
  KO
K17386  platelet-derived growth factor subunit B
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04020  Calcium signaling pathway
ray04072  Phospholipase D signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04510  Focal adhesion
ray04540  Gap junction
ray04630  JAK-STAT signaling pathway
ray04810  Regulation of actin cytoskeleton
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05200  Pathways in cancer
ray05206  MicroRNAs in cancer
ray05211  Renal cell carcinoma
ray05214  Glioma
ray05215  Prostate cancer
ray05218  Melanoma
ray05231  Choline metabolism in cancer
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107502078 (PDGFB)
   04014 Ras signaling pathway
    107502078 (PDGFB)
   04015 Rap1 signaling pathway
    107502078 (PDGFB)
   04630 JAK-STAT signaling pathway
    107502078 (PDGFB)
   04020 Calcium signaling pathway
    107502078 (PDGFB)
   04072 Phospholipase D signaling pathway
    107502078 (PDGFB)
   04151 PI3K-Akt signaling pathway
    107502078 (PDGFB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107502078 (PDGFB)
   04540 Gap junction
    107502078 (PDGFB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107502078 (PDGFB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107502078 (PDGFB)
   05206 MicroRNAs in cancer
    107502078 (PDGFB)
   05231 Choline metabolism in cancer
    107502078 (PDGFB)
  09162 Cancer: specific types
   05214 Glioma
    107502078 (PDGFB)
   05218 Melanoma
    107502078 (PDGFB)
   05211 Renal cell carcinoma
    107502078 (PDGFB)
   05215 Prostate cancer
    107502078 (PDGFB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107502078 (PDGFB)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    107502078 (PDGFB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107502078 (PDGFB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107502078 (PDGFB)
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107502078 (PDGFB)
Cytokines and growth factors [BR:ray04052]
 Growth factors
  Growth factors (RTK binding)
   107502078 (PDGFB)
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   107502078 (PDGFB)
SSDB
Motif
Pfam: PDGF PDGF_N
Other DBs
NCBI-GeneID: 107502078
NCBI-ProteinID: XP_015984384
LinkDB
Position
Unknown
AA seq 367 aa
MVAATPAFSRGLRPALAPAPGRDGLPRARTGHAQPQSAVPERLAYWARRGCGETGFGHSG
LGRSGGLLRNPALRRCVPAAPPYLRPRPARGITSLPRLQGAERAAWKSLACKGGGLQKRL
QELSGRISPPPLLASRSSELASLPGIQGDPIPEELYEMLSDHSIRSFDDLQRLLHGDSVD
EDGAELDLNLTQSHSGGKSESLSRGRRSLDATTVAEPAMIAECKTRTEVFEISRRLVDRT
NANFLVWPPCVEVQRCSGCCSNRHVQCRPTQVQLRHVQVRKIEIVRKKPSFKKATVTLED
HLACKCETVVAARPVTRSPGSSQEQRAKTPQTRMTIRTVRVRRPPKGKHRKFKHTHDKKV
LKETLGA
NT seq 1104 nt   +upstreamnt  +downstreamnt
atggttgcggccacgccggccttcagcagaggtctgcgtcccgccctggctcccgctccc
ggtcgggatgggctccctcgggcccgcacagggcatgcccagccccagagcgcggtcccg
gagcggctggcgtattgggcgcggcgcgggtgcggagagacaggcttcgggcactcggga
ttagggaggagtggggggctcttaaggaatccagccctaaggcggtgtgtgcctgcggcc
ccgccatacctgcgcccgcgccctgcgagaggaatcacctctctccctcgcttgcagggt
gcggagcgcgccgcctggaaaagcctggcttgcaagggaggtgggctacaaaaacgtctg
caggagctctcgggtcggatcagtcccccgcccctcctagcctcacgtagcagtgagttg
gcaagtctacccggaatccagggagaccccatccccgaggagctctacgagatgctgagt
gaccactctatccgctccttcgatgacctccagcgcctgctgcacggagactccgtagat
gaagatggggctgaattggacctgaatttgacccagtcccattccggaggcaagtcagag
agcttatcccgagggagaaggagcctagacgccacgacggtcgccgagccagccatgatc
gccgagtgcaagacccgcaccgaggtgttcgagatctcccggcgcctcgtcgaccgcacc
aacgccaacttcctggtgtggccgccctgcgtggaggtgcagcgctgctccggctgctgc
agcaaccgccacgtgcagtgccgccccacccaggtgcagctgcgccacgtccaggtgaga
aagatcgagattgtgcggaagaagccgagctttaagaaggccacagtgaccctggaggac
cacctggcatgcaagtgtgagacggtggtggccgcaagacctgtgacccgaagcccaggg
agttcccaggagcagcgagccaagacgccccaaactcggatgaccatcaggacagtgcga
gtccgccggccccccaaggggaagcacaggaagttcaagcacacgcatgacaagaaggtg
ctgaaggagacccttggagcctag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107502706
Entry
107502706         CDS       T06036                                 

Gene name
FGF20
Definition
(RefSeq) fibroblast growth factor 20
  KO
K04358  fibroblast growth factor
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04020  Calcium signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04810  Regulation of actin cytoskeleton
ray05200  Pathways in cancer
ray05218  Melanoma
ray05224  Breast cancer
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107502706 (FGF20)
   04014 Ras signaling pathway
    107502706 (FGF20)
   04015 Rap1 signaling pathway
    107502706 (FGF20)
   04020 Calcium signaling pathway
    107502706 (FGF20)
   04151 PI3K-Akt signaling pathway
    107502706 (FGF20)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107502706 (FGF20)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107502706 (FGF20)
  09162 Cancer: specific types
   05226 Gastric cancer
    107502706 (FGF20)
   05218 Melanoma
    107502706 (FGF20)
   05224 Breast cancer
    107502706 (FGF20)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107502706 (FGF20)
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107502706 (FGF20)
Cytokines and growth factors [BR:ray04052]
 Growth factors
  Growth factors (RTK binding)
   107502706 (FGF20)
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   107502706 (FGF20)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 107502706
NCBI-ProteinID: XP_015985645
LinkDB
Position
Unknown
AA seq 211 aa
MAPLAEVGGFLGGLEGLGQQVGSHFLLPPAGERPPLLGERLGTAERGARGGPGAAELAHL
HGILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLG
MNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGAK
SKRHQKFTHFLPRPVDPERVPELYKDILIYS
NT seq 636 nt   +upstreamnt  +downstreamnt
atggctccgttagctgaagtcgggggcttcctgggtggcctggagggcttgggccagcag
gtgggctcgcacttcctgctgcctcctgccggggagcggccaccgctgctgggcgagcgc
ctgggcacggcggagaggggcgcccgcggcgggcccggggctgcggagctggcgcacctg
cacggcatcctgcgccgccggcagctctactgccgcaccggcttccacctgcagatcctg
ccggacggcagcgtgcaaggcacccggcaggaccacagtctcttcggtatcctggaattc
atcagtgtggcagtgggactggtcagtattagaggtgtggacagtggcctttaccttgga
atgaatgacaaaggagaactctatggatcagagaaactgacttctgaatgcatctttaga
gagcaatttgaagagaactggtataacacttattcgtccaacatatataaacatggtgac
acaggccgcaggtattttgtggcacttaacaaagatggaactccaagagatggtgctaag
tccaaaagacatcagaaatttacacattttctgcctagaccagtggatccagaaagagtt
cctgaattgtataaggacatactgatatacagttga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107503931
Entry
107503931         CDS       T06036                                 

Gene name
FGF3
Definition
(RefSeq) fibroblast growth factor 3
  KO
K04358  fibroblast growth factor
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04020  Calcium signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04810  Regulation of actin cytoskeleton
ray05200  Pathways in cancer
ray05218  Melanoma
ray05224  Breast cancer
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107503931 (FGF3)
   04014 Ras signaling pathway
    107503931 (FGF3)
   04015 Rap1 signaling pathway
    107503931 (FGF3)
   04020 Calcium signaling pathway
    107503931 (FGF3)
   04151 PI3K-Akt signaling pathway
    107503931 (FGF3)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107503931 (FGF3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107503931 (FGF3)
  09162 Cancer: specific types
   05226 Gastric cancer
    107503931 (FGF3)
   05218 Melanoma
    107503931 (FGF3)
   05224 Breast cancer
    107503931 (FGF3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107503931 (FGF3)
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107503931 (FGF3)
Cytokines and growth factors [BR:ray04052]
 Growth factors
  Growth factors (RTK binding)
   107503931 (FGF3)
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   107503931 (FGF3)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 107503931
NCBI-ProteinID: XP_015988224
LinkDB
Position
Unknown
AA seq 226 aa
MGLIWLLLLSLLEPAAGRRARGARRRGGRRGGGRRLEHLGGAPRRRKLYCATKYHLQLHP
SGRVNGSLENSAYSILEITAVEVGVVAIKGLFSGRYLAMNRRGRLYASENYNAECEFVER
IHELGYNTYASRLYRTAAAGGPGARRQPGADRLWYVSVNGKGRPRRGFKTRRTQKSSLFL
PRVLDHKDHEMVRLLQGVAGLRGGPPGSGAQPRQRRRRQRRPGGRA
NT seq 681 nt   +upstreamnt  +downstreamnt
atgggcctgatctggctgctgctgctcagcctgctggagcccgccgctggccggcgggcc
cggggcgcccggcgccgcggcgggcggcgcggcggcgggcggcgtctagagcacctcggc
ggggcgccccggcgccgcaagctctactgcgccaccaagtaccacctccagctgcacccg
agcggccgcgtcaacggcagcctggagaacagcgcctacagtatcctggaaatcacggcc
gtggaggtgggcgtcgtggccatcaaggggctcttctctgggcggtacctcgccatgaac
cggagggggcggctctatgcctcggagaactacaacgcggagtgcgagtttgtggagcga
atccacgagctgggctacaacacgtacgcctcgcggctgtaccggacggcggcggccggc
gggcccggggcgcggcgccagcccggcgcggacagactgtggtacgtgtcggtgaacggc
aagggccggccgcgccgcggcttcaagacgcgccgcacgcagaagtcctcgctcttcctg
cctcgcgtgctggaccacaaggaccacgagatggtgcggctgctccagggcgtggccggg
ctccgcggcggccctccgggcagcggcgcgcagccccggcagcggcgacggcggcagagg
cgccccgggggccgtgcttag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107503977
Entry
107503977         CDS       T06036                                 

Gene name
FGF4
Definition
(RefSeq) LOW QUALITY PROTEIN: fibroblast growth factor 4
  KO
K04358  fibroblast growth factor
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04020  Calcium signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04810  Regulation of actin cytoskeleton
ray05200  Pathways in cancer
ray05218  Melanoma
ray05224  Breast cancer
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107503977 (FGF4)
   04014 Ras signaling pathway
    107503977 (FGF4)
   04015 Rap1 signaling pathway
    107503977 (FGF4)
   04020 Calcium signaling pathway
    107503977 (FGF4)
   04151 PI3K-Akt signaling pathway
    107503977 (FGF4)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107503977 (FGF4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107503977 (FGF4)
  09162 Cancer: specific types
   05226 Gastric cancer
    107503977 (FGF4)
   05218 Melanoma
    107503977 (FGF4)
   05224 Breast cancer
    107503977 (FGF4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107503977 (FGF4)
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107503977 (FGF4)
Cytokines and growth factors [BR:ray04052]
 Growth factors
  Growth factors (RTK binding)
   107503977 (FGF4)
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   107503977 (FGF4)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 107503977
NCBI-ProteinID: XP_015988340
LinkDB
Position
Unknown
AA seq 205 aa
MARPAGAAALLPAVLXAVLAPWAGRGGAAAPAAPNGTLEAELERRWDSLVARSLARLPVA
AQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHIQVLRDGRIGGVHADTSDSLLELSPV
ERGVVSIFGVASRFFVAMSNKGKLYGSPFFTDECKFKEILLPNNYNAYECYRYPGMFVAL
SKNGKTKKGNRVSPTMKVTHFLPRL
NT seq 618 nt   +upstreamnt  +downstreamnt
atggcgcggcccgcgggcgcggcggcgctgctccccgccgtcctgnctgcggtgctggcg
ccctgggccggccgagggggcgccgccgcgcccgccgcacccaacggcacgctggaggcc
gagctggagcgccgctgggacagcctggtggcgcgctcgctggcgcgcctgccggtggcc
gcgcagcccaaggaggcggcggtgcagagcggcgccggcgactacctgctgggcatcaag
cggctgcgccggctctactgcaacgtgggcatcggcttccacatccaggtgctccgcgac
ggccgcatcggcggcgtgcacgcggacacgagcgacagcctgctggagctctcgcccgtg
gagcggggtgtggtgagcatcttcggcgtggccagtcggttcttcgtggccatgagcaac
aagggcaagctgtacggctcgcctttcttcactgacgagtgcaagttcaaggagatcctt
ctccccaacaactacaacgcctacgagtgctacaggtaccccggcatgttcgtcgccctg
agcaagaacgggaagaccaagaaggggaaccgagtgtcccccaccatgaaggtcacccac
ttcctccccaggctgtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107507115
Entry
107507115         CDS       T06036                                 

Gene name
FGF16
Definition
(RefSeq) fibroblast growth factor 16
  KO
K04358  fibroblast growth factor
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04020  Calcium signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04810  Regulation of actin cytoskeleton
ray05200  Pathways in cancer
ray05218  Melanoma
ray05224  Breast cancer
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107507115 (FGF16)
   04014 Ras signaling pathway
    107507115 (FGF16)
   04015 Rap1 signaling pathway
    107507115 (FGF16)
   04020 Calcium signaling pathway
    107507115 (FGF16)
   04151 PI3K-Akt signaling pathway
    107507115 (FGF16)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107507115 (FGF16)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107507115 (FGF16)
  09162 Cancer: specific types
   05226 Gastric cancer
    107507115 (FGF16)
   05218 Melanoma
    107507115 (FGF16)
   05224 Breast cancer
    107507115 (FGF16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107507115 (FGF16)
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107507115 (FGF16)
Cytokines and growth factors [BR:ray04052]
 Growth factors
  Growth factors (RTK binding)
   107507115 (FGF16)
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   107507115 (FGF16)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 107507115
NCBI-ProteinID: XP_015993609
LinkDB
Position
Unknown
AA seq 207 aa
MAEVGGVFASLDWDLHGFSSSLGSMPLADSPGFLNERLGQIEGKLQRGSPTDFAHLKGIL
RRRQLYCRTGFHLEIFPNGTVQGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNER
GELYGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRH
QKFTHFLPRPVDPSKLPSMSRDLFRYR
NT seq 624 nt   +upstreamnt  +downstreamnt
atggcggaggtggggggggtcttcgcttccttggactgggatctgcatggtttctcctcg
tctctggggagcatgcccttagctgactcccccggtttcctgaacgagcgcctgggccag
atcgaggggaagctgcagcgcggctcgcccacagacttcgcccacctgaaggggatcctg
cggcgccgccagttgtactgccgcacaggcttccacctggagatcttccccaatggcacg
gtacagggcacacgtcacgaccacagccgattcggcatcctggagtttatcagcctggct
gtggggctgatcagcatccggggagtggactctggcctatacttaggaatgaacgaacga
ggagagctttatgggtcgaagaaactcacacgtgaatgtgttttccgggaacagtttgaa
gaaaactggtacaacacttatgcctccaccttatacaaacactcggactcggagagacag
tattatgtggctctgaataaagatggctcaccacgggagggatacaggactaaacgacac
cagaaattcactcactttttacccaggccagtagatccttctaagttgccatccatgtcc
agagacctcttccgctataggtaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107507553
Entry
107507553         CDS       T06036                                 

Gene name
PDGFC
Definition
(RefSeq) platelet-derived growth factor C isoform X1
  KO
K05450  platelet derived growth factor C/D
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04020  Calcium signaling pathway
ray04072  Phospholipase D signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04510  Focal adhesion
ray04540  Gap junction
ray04810  Regulation of actin cytoskeleton
ray05215  Prostate cancer
ray05218  Melanoma
ray05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107507553 (PDGFC)
   04014 Ras signaling pathway
    107507553 (PDGFC)
   04015 Rap1 signaling pathway
    107507553 (PDGFC)
   04020 Calcium signaling pathway
    107507553 (PDGFC)
   04072 Phospholipase D signaling pathway
    107507553 (PDGFC)
   04151 PI3K-Akt signaling pathway
    107507553 (PDGFC)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107507553 (PDGFC)
   04540 Gap junction
    107507553 (PDGFC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107507553 (PDGFC)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    107507553 (PDGFC)
  09162 Cancer: specific types
   05218 Melanoma
    107507553 (PDGFC)
   05215 Prostate cancer
    107507553 (PDGFC)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107507553 (PDGFC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107507553 (PDGFC)
Cytokines and growth factors [BR:ray04052]
 Growth factors
  Growth factors (RTK binding)
   107507553 (PDGFC)
SSDB
Motif
Pfam: CUB PDGF
Other DBs
NCBI-GeneID: 107507553
NCBI-ProteinID: XP_015994155
LinkDB
Position
Unknown
AA seq 345 aa
MLLFGLLLLTSALAGQRHGTQAESNLSSKFQFSSNKEQNGVQDSQHERIVTVSTNGSIHS
PKFPHTYPRNMVLVWRLVAAEENVWIQLTFDERFGLEDPEDDICKYDFVEVEDPSDGTVL
GRWCGSGTVPGKQISKGNQIRIRFVSDEYFPSEPGFCIHYNVVMPQFTEAVSPSVLPPSA
LPLDLLNNAVAAFSTLEDLIRYLEPDRWQLDLEDLYRPTWQLLGKAFVFGRKSRVVDLNL
LKEEVRLYSCTPRNFSVSVREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSK
VTKKYHEVLQLRPKVGVRGLHKSLTDVALEHHEECDCVCRGNAGG
NT seq 1038 nt   +upstreamnt  +downstreamnt
atgctcctcttcgggcttctcctgctgacatccgccctggccggccagagacacgggact
caggctgagtccaacctgagtagtaaattccagttctccagcaacaaggaacagaacggg
gtacaagattcccagcatgagagaattgttactgtgtctactaatggaagtattcacagc
ccaaagtttcctcatacttatccaagaaatatggtcttggtgtggagattagtagcggca
gaggaaaatgtatggatacagcttacatttgatgaaagatttgggcttgaagacccagaa
gatgacatatgcaagtatgattttgtagaagttgaggaccccagtgatggaactgtatta
gggcgctggtgtggctctgggactgtgccaggaaaacagatttctaaaggaaatcaaatc
aggataagatttgtatctgatgaatattttccttctgaaccaggtttctgcatccactat
aatgttgtcatgccacagttcacagaagctgtgagtccttccgtgttacccccctcagct
ttgccactggacctgcttaataacgctgtcgctgcctttagtaccttggaagaccttatt
cggtatcttgaaccagataggtggcagttggacttagaagatctatacaggccaacttgg
caacttcttggcaaggcttttgtttttggaagaaaatccagagtagtggatctgaacctt
ctaaaagaggaggtaagattatacagctgcacacctcgtaacttctcggtgtctgtaagg
gaagaactaaagagaaccgataccattttctggccaggttgtctcctggttaaacgctgt
ggtggaaactgtgcctgttgtctccacaactgcaatgaatgtcaatgtgtcccaagcaaa
gttactaaaaaatatcatgaggtccttcagttgagaccaaaggttggtgtcagggggttg
cacaaatctctcactgacgtggccctcgagcaccacgaggagtgtgactgtgtgtgcaga
gggaacgcgggaggataa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107508819
Entry
107508819         CDS       T06036                                 

Gene name
EGF
Definition
(RefSeq) pro-epidermal growth factor isoform X1
  KO
K04357  epidermal growth factor
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray04010  MAPK signaling pathway
ray04012  ErbB signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04020  Calcium signaling pathway
ray04066  HIF-1 signaling pathway
ray04068  FoxO signaling pathway
ray04072  Phospholipase D signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04510  Focal adhesion
ray04540  Gap junction
ray04630  JAK-STAT signaling pathway
ray04810  Regulation of actin cytoskeleton
ray05160  Hepatitis C
ray05165  Human papillomavirus infection
ray05200  Pathways in cancer
ray05210  Colorectal cancer
ray05212  Pancreatic cancer
ray05213  Endometrial cancer
ray05214  Glioma
ray05215  Prostate cancer
ray05218  Melanoma
ray05219  Bladder cancer
ray05223  Non-small cell lung cancer
ray05224  Breast cancer
ray05226  Gastric cancer
ray05231  Choline metabolism in cancer
ray05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107508819 (EGF)
   04012 ErbB signaling pathway
    107508819 (EGF)
   04014 Ras signaling pathway
    107508819 (EGF)
   04015 Rap1 signaling pathway
    107508819 (EGF)
   04630 JAK-STAT signaling pathway
    107508819 (EGF)
   04066 HIF-1 signaling pathway
    107508819 (EGF)
   04068 FoxO signaling pathway
    107508819 (EGF)
   04020 Calcium signaling pathway
    107508819 (EGF)
   04072 Phospholipase D signaling pathway
    107508819 (EGF)
   04151 PI3K-Akt signaling pathway
    107508819 (EGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107508819 (EGF)
   04540 Gap junction
    107508819 (EGF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107508819 (EGF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107508819 (EGF)
   05231 Choline metabolism in cancer
    107508819 (EGF)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107508819 (EGF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107508819 (EGF)
   05212 Pancreatic cancer
    107508819 (EGF)
   05226 Gastric cancer
    107508819 (EGF)
   05214 Glioma
    107508819 (EGF)
   05218 Melanoma
    107508819 (EGF)
   05219 Bladder cancer
    107508819 (EGF)
   05215 Prostate cancer
    107508819 (EGF)
   05213 Endometrial cancer
    107508819 (EGF)
   05224 Breast cancer
    107508819 (EGF)
   05223 Non-small cell lung cancer
    107508819 (EGF)
  09172 Infectious disease: viral
   05160 Hepatitis C
    107508819 (EGF)
   05165 Human papillomavirus infection
    107508819 (EGF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107508819 (EGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107508819 (EGF)
Cytokines and growth factors [BR:ray04052]
 Growth factors
  Growth factors (RTK binding)
   107508819 (EGF)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition cEGF EGF_CA DUF5050 EGF EGF_3 Tr-sialidase_C
Other DBs
NCBI-GeneID: 107508819
NCBI-ProteinID: XP_015996313
LinkDB
Position
Unknown
AA seq 1124 aa
MLLFLVILLPVVFKSGFVSLSALPRWNCPEESPSGNGNPACVGPAPFLIFSHGNSIFRID
LEGTNYEKLVTDAGVSVIMDFHYNKERIYWVDLERQLLQRVFLNGTRQERVCNIEKNVSG
MAINWINEELIWSNQQEGIITITDMKGNNSRVLLSALKYPANVAVDPVERFIFWSSEVAG
SLQRTDLSGVEVKILVETAEKITAMSLDVLDKRLFWVQYDREGSNSRICSCDYDGGSVHF
SKYLSQHNLFSISLFGDRIFYSTWRKKTIWIANKHTGKDIVRINLNASFVPPGGIKVVHL
IGQPRAEDDAWASDQNFCRLRKGNCRGSVCGQDLKSHSCTCAEGYALSQDGKYCEDVNEC
AFWNHGCTLGCENIPGSYYCTCPVGFVLLPDGKRCHQLISCPSNASECSHECVLTSDGPI
CFCPEGSVLGTDGKTCSGCSSPDNGGCSQLCIPLSPVSWECGCYPGYDLRLDKKSCAASG
PQPFLLFANSQDIRHMHFDGTDYGTLLSKQMGTVFAIDHDPVENKVYFAHTALKCIERAN
MDGSQRERLIEEAIDVPEGLAIDWINRKLYWTDRGKSVIEGSDLSGKHREIIIKEDISRP
RGIAVHPVAKRLFWTDMGINPRIESSSLQGFGRLVIASSELVWPSGITIDFLTDKLYWCD
AKQSVIEMANLDGSKRQRLAQNDVGRPFAVAVFEDYIWFSDWTVPSVIRVNKRTGKNRVR
LRGSMLKPSSLVVVHPLAKPGADPCLYRNGGCEHICKEKFGTVQCSCREGFVKAPDGKLC
LALNGHQIAAGSGTDLSNQVKPSDILLSSQGFEDNITESQHVLVSEIMASDDDDCGPMGC
GAHSQCVSEGEVATCQCLKGFAGDGKLCSDIDECEMDVTVCPHPSSKCINTEGGHVCQCS
QGYQGDGIHCLDIDECQLGMHTCGENATCTNAEGNYTCLCAGIPSEPGRICPDSTPPSHL
REDGHYSVRNSYSECPPSHAGYCLHDGVCMYIEAVDNYACNCIVGYVGERCQHRDLKWWE
LRHAGHGRQRSLAVGAVCVLVLVLLLLLGLWGAHCYRTQKLLSKNQKSPYEESCRDPSIS
RPADGEARVSSCPQPWFVVIKEHENLRNGDPPVAPRDGQAAVAD
NT seq 3375 nt   +upstreamnt  +downstreamnt
atgctgctcttccttgtcattctgttgccggtagtttttaagtctggttttgttagtctc
tcagcactgcctcgctggaactgtcctgaagagtctccctctggaaatgggaatcctgct
tgtgtgggtcctgcacccttcttaattttctctcatggaaatagtatctttaggattgac
ctggaaggaactaattatgagaaattggtgacagatgctggcgtatcagtgatcatggat
tttcattacaataaggaaagaatctattgggtagatctagaaagacaacttttgcaaaga
gtttttctgaatgggacaaggcaagagagagtatgcaatatagagaaaaatgtttcagga
atggcaataaattggataaatgaagaacttatttggtcaaatcaacaggaaggaatcatt
acaataacagatatgaaaggaaacaattcccgtgttctcttaagtgccttaaaatatcct
gcaaatgtagcggttgatccagtagaaaggtttatattttggtcttcagaggtggccggc
agccttcagaggacagatctcagtggtgtggaagtgaagattctggtagagacggcagag
aaaataacagctatgtcgttggatgtgcttgataaacggctcttttgggttcagtatgac
agagaaggaagcaattctcgtatttgttcctgtgattatgatggaggttctgtccatttt
agtaaatatctttcacagcacaatttgttttcaatatccctttttggtgaccgaatcttc
tattcaacatggagaaagaagacaatttggatagctaacaaacacactgggaaggatata
gttcgaattaacctcaatgcatcatttgtaccacctggaggaattaaagtagtgcacctg
atcggacagcccagggcagaggatgatgcttgggcatctgatcagaacttctgcagactg
aggaaaggcaactgcagaggcagcgtgtgtgggcaagaccttaagtcccattcgtgcacg
tgtgcggagggatatgctttaagccaggacggaaagtattgtgaagatgttaatgaatgt
gctttttggaaccatggctgcactcttggatgcgaaaacatccctggatcctattattgc
acatgccctgtaggatttgttctgcttcctgatggaaaacggtgtcaccaattaatttcc
tgtccaagcaatgcatctgaatgcagccatgagtgcgttctgacttcagatggtcccata
tgtttctgtcctgaaggttcagtgcttgggacagatggaaaaacgtgtagtggctgttca
tcacctgataatggtggatgtagccagctctgcatccctctcagcccagtatcctgggaa
tgtggttgctaccctggttatgacctacgactggacaaaaaaagctgtgcagcttcagga
ccacaaccatttttgctgtttgccaattctcaagatattcgacacatgcattttgatgga
acagattatggaaccctgctcagcaagcaaatgggaacggttttcgccatagatcatgac
cctgtggaaaataaggtatactttgcccatacagccctcaagtgcatagagagagcaaat
atggatggttcccagagagaaaggcttatcgaggaagcaatagatgtgccagaaggtctt
gctatagactggatcaatcgtaaactctattggacagacagagggaaatcggtcattgaa
ggcagtgatttaagtggaaaacatcgtgaaataatcattaaggaagacatctctcggcca
cgaggaattgctgtccatccagtggccaagagattattctggactgatatgggaattaat
ccacgaattgaaagttcttccctccaaggctttggccgactggtcatcgctagctctgag
ctggtctggcccagtggaataacgattgacttcctaaccgacaagttgtattggtgcgat
gccaagcaatctgtgattgaaatggctaatctggatggttcgaaacgccaaagacttgcc
cagaacgatgtaggtcgcccctttgctgtggctgtgtttgaggattacatctggttctcc
gactggactgtgccctcggtaataagagtgaacaagaggactggcaaaaacagggtacgt
ctccgaggcagcatgctgaagccctcatcactggttgtagttcatccattggcaaaacca
ggagcagatccctgcttatatcgaaatggaggctgtgaacatatttgcaaagagaagttt
ggaactgttcagtgttcgtgtcgtgaaggttttgtgaaagccccagatgggaaactgtgt
ctggccctaaatggtcatcagatagcggcaggtagtggaacagatctaagtaatcaagta
aaaccatcggacatcttactcagcagtcaagggtttgaagataatattacagaatcgcaa
catgtgctagtgtctgaaatcatggcatcagatgatgacgactgtggtcccatggggtgt
ggtgcacactctcagtgtgtttcagagggagaggtggccacgtgtcagtgtttgaaagga
tttgctggggatggaaaattatgttctgatatagatgaatgtgagatggatgttacagtt
tgcccgcacccctcctccaagtgcatcaatactgaaggtggccatgtctgccagtgctca
caaggctaccaaggagacggaattcactgtctcgatattgatgagtgccaactgggcatg
cacacctgtggggaaaatgccacctgtacaaacgcagagggaaactacacctgcctgtgt
gccggcatcccgtctgaacctggacggatttgccctgactccactccaccctctcatctc
agggaagatggtcactattctgtgaggaatagttactccgaatgtcccccgtcccacgct
gggtactgcctccacgacggtgtgtgcatgtacattgaagccgtggacaactacgcatgc
aactgtattgttggctacgtcggggagcgatgtcagcaccgagacttgaaatggtgggaa
ctgcgccacgctggccacgggcggcagcggagcctggcggtgggggccgtctgcgtcctg
gtgctcgtcctgctgctgctcctggggctgtggggcgcgcactgctacaggactcagaag
ctgctatcaaaaaatcagaagagcccttacgaagagtcatgcagagatccgagcatcagc
aggcctgcagacggagaggccagggtgtcctcctgtccccagccttggtttgtggttata
aaggaacacgagaacctcaggaatggggatccacccgtggctccccgggatggccaggcc
gcagttgctgactag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107509200
Entry
107509200         CDS       T06036                                 

Gene name
FGF17
Definition
(RefSeq) fibroblast growth factor 17 isoform X1
  KO
K04358  fibroblast growth factor
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04020  Calcium signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04810  Regulation of actin cytoskeleton
ray05200  Pathways in cancer
ray05218  Melanoma
ray05224  Breast cancer
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107509200 (FGF17)
   04014 Ras signaling pathway
    107509200 (FGF17)
   04015 Rap1 signaling pathway
    107509200 (FGF17)
   04020 Calcium signaling pathway
    107509200 (FGF17)
   04151 PI3K-Akt signaling pathway
    107509200 (FGF17)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107509200 (FGF17)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107509200 (FGF17)
  09162 Cancer: specific types
   05226 Gastric cancer
    107509200 (FGF17)
   05218 Melanoma
    107509200 (FGF17)
   05224 Breast cancer
    107509200 (FGF17)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107509200 (FGF17)
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107509200 (FGF17)
Cytokines and growth factors [BR:ray04052]
 Growth factors
  Growth factors (RTK binding)
   107509200 (FGF17)
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   107509200 (FGF17)
SSDB
Motif
Pfam: FGF Fascin Alveol-reg_P311
Other DBs
NCBI-GeneID: 107509200
NCBI-ProteinID: XP_015997009
LinkDB
Position
Unknown
AA seq 216 aa
MGAARPLPGFTLCVQLLILCCQTQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSR
TSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMSKRGKLIGKP
SGRSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYE
GQLPFPNQVERQKQFEFVGSAPTRRTKRTRRPQPLT
NT seq 651 nt   +upstreamnt  +downstreamnt
atgggagccgcccgcccgctgcccggctttactctgtgcgtgcagctactgatcctctgc
tgtcaaactcagggggagaatcacccgtctcctaattttaaccagtatgtgagggaccag
ggcgccatgactgaccagctgagccggcggcagatccgcgagtaccagctgtacagccgg
accagcggcaagcacgtgcaggtcacggggcgtcgcatctccgccaccgccgaggacggc
aacaagtttgccaagctcatagtagagacggacacgttcgggagccgcgtgcgcatcaag
ggagccgagagtgagaagtacatctgcatgagcaagcgcggcaagctcatcggcaagccc
agcgggaggagcaaagactgcgtgttcacggagatcgtgctggagaacaactacacggcc
ttccagaatgccaggcacgagggctggttcatggccttcacgcggcagggccggccccgc
caggcctcccgcagccgccagaaccagcgcgaggcacacttcatcaagcggctctacgag
ggccagctgcccttccccaaccaagtcgagaggcagaagcagttcgagttcgtgggctca
gcacccacccgccggaccaagcgcactcggaggccgcagcccctgacgtag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107511020
Entry
107511020         CDS       T06036                                 

Gene name
FGF18
Definition
(RefSeq) fibroblast growth factor 18
  KO
K04358  fibroblast growth factor
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04020  Calcium signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04810  Regulation of actin cytoskeleton
ray05200  Pathways in cancer
ray05218  Melanoma
ray05224  Breast cancer
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107511020 (FGF18)
   04014 Ras signaling pathway
    107511020 (FGF18)
   04015 Rap1 signaling pathway
    107511020 (FGF18)
   04020 Calcium signaling pathway
    107511020 (FGF18)
   04151 PI3K-Akt signaling pathway
    107511020 (FGF18)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107511020 (FGF18)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107511020 (FGF18)
  09162 Cancer: specific types
   05226 Gastric cancer
    107511020 (FGF18)
   05218 Melanoma
    107511020 (FGF18)
   05224 Breast cancer
    107511020 (FGF18)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107511020 (FGF18)
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107511020 (FGF18)
Cytokines and growth factors [BR:ray04052]
 Growth factors
  Growth factors (RTK binding)
   107511020 (FGF18)
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   107511020 (FGF18)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 107511020
NCBI-ProteinID: XP_016000573
LinkDB
Position
Unknown
AA seq 207 aa
MYSAPSACTCLCLHFLLLCFQVQVLAAEENVDFRIHVENQTRARDDVSRKQLRLYQLYSR
TSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKP
DGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPK
GQAELQKPFKYTTVTKRSRRIRPTHPG
NT seq 624 nt   +upstreamnt  +downstreamnt
atgtattcagcgccctccgcctgcacttgcctgtgtttacacttcctgctgctgtgcttc
caggtacaggtgctggcggccgaggagaacgtggacttccgcatccacgtggagaaccag
acgcgggctcgggacgatgtgagccgtaagcagctgcggctgtaccagctctacagccgg
accagcgggaagcacatccaggtcctgggccgccggatcagcgcccgtggcgaggacggc
gacaagtatgcccagctcctagtggaaacagacaccttcggtagtcaagtccggatcaag
ggcaaggagacggagttctacctgtgcatgaaccggaaaggcaagctcgtggggaagcct
gatggcaccagtaaggagtgtgtgttcatcgagaaggtcctggagaacaactacacggcc
ctgatgtcggccaagtactccggctggtacgtgggcttcaccaagaaggggcggccgagg
aagggccccaagacccgggagaaccagcaggacgtgcacttcatgaagcgctatcccaag
gggcaggcagagctgcagaagcccttcaagtacaccacagtgaccaagaggtcccggcgg
atccgccccacgcaccccggctag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513447
Entry
107513447         CDS       T06036                                 

Gene name
FGF6
Definition
(RefSeq) fibroblast growth factor 6
  KO
K04358  fibroblast growth factor
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04020  Calcium signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04810  Regulation of actin cytoskeleton
ray05200  Pathways in cancer
ray05218  Melanoma
ray05224  Breast cancer
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107513447 (FGF6)
   04014 Ras signaling pathway
    107513447 (FGF6)
   04015 Rap1 signaling pathway
    107513447 (FGF6)
   04020 Calcium signaling pathway
    107513447 (FGF6)
   04151 PI3K-Akt signaling pathway
    107513447 (FGF6)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107513447 (FGF6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107513447 (FGF6)
  09162 Cancer: specific types
   05226 Gastric cancer
    107513447 (FGF6)
   05218 Melanoma
    107513447 (FGF6)
   05224 Breast cancer
    107513447 (FGF6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107513447 (FGF6)
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107513447 (FGF6)
Cytokines and growth factors [BR:ray04052]
 Growth factors
  Growth factors (RTK binding)
   107513447 (FGF6)
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   107513447 (FGF6)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 107513447
NCBI-ProteinID: XP_016005623
LinkDB
Position
Unknown
AA seq 208 aa
MALGQRLFITMSRGAGRLQGTLQALVFLGVLVGMVVPSPAGTRANSTLLDSRGWGTLLSR
SRAGLAGEIAGVNWESGYLVGIKRQRRLYCNVGIGFHLQVPPDGRISGTHEENPYSLLEI
STVERGVVSLFGVKSALFVAMNSKGRLYTTPSFQEECKFRETLLPNNYNAYESDLYRGTY
IALSKYGRVKRGNKVSPIMTVTHFLPRI
NT seq 627 nt   +upstreamnt  +downstreamnt
atggccctgggacagaggctgttcatcactatgtcccggggagcaggacgtcttcagggc
acgctgcaggctctcgtcttcctaggcgtcctagtgggcatggtggtgccctcacctgcg
ggcacccgcgccaacagcacgctgctggactccaggggctggggcaccctgctgtccagg
tcccgagctgggctagctggagagattgccggggtgaattgggaaagtggctatttggtg
gggatcaagcggcagcggaggctctactgcaacgtgggcatcggctttcaccttcaggtg
ccccccgacggccggatcagcgggacccacgaggagaacccctacagcctgctggagatt
tccacagtggaacgcggtgtggtgagtctctttggagtgaaaagcgcccttttcgttgcc
atgaacagcaaaggaagattatacacaacgcccagcttccaagaggaatgcaagttcaga
gaaaccctcctgcccaacaattacaatgcctatgagtcagacctgtaccgagggacctac
atcgcactgagcaaatatggacgtgtaaagcggggcaacaaggtgtccccaatcatgacc
gtcactcatttccttcccaggatataa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513448
Entry
107513448         CDS       T06036                                 

Gene name
FGF23
Definition
(RefSeq) fibroblast growth factor 23
  KO
K22428  fibroblast growth factor 23
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04020  Calcium signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04810  Regulation of actin cytoskeleton
ray04928  Parathyroid hormone synthesis, secretion and action
ray05200  Pathways in cancer
ray05218  Melanoma
ray05224  Breast cancer
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107513448 (FGF23)
   04014 Ras signaling pathway
    107513448 (FGF23)
   04015 Rap1 signaling pathway
    107513448 (FGF23)
   04020 Calcium signaling pathway
    107513448 (FGF23)
   04151 PI3K-Akt signaling pathway
    107513448 (FGF23)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107513448 (FGF23)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    107513448 (FGF23)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107513448 (FGF23)
  09162 Cancer: specific types
   05226 Gastric cancer
    107513448 (FGF23)
   05218 Melanoma
    107513448 (FGF23)
   05224 Breast cancer
    107513448 (FGF23)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107513448 (FGF23)
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107513448 (FGF23)
Cytokines and growth factors [BR:ray04052]
 Growth factors
  Growth factors (RTK binding)
   107513448 (FGF23)
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   107513448 (FGF23)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 107513448
NCBI-ProteinID: XP_016005625
LinkDB
Position
Unknown
AA seq 351 aa
MPSVSLREVCAFSSDGLITTQRMWTVEVFLFDVTLLPFKRLREKRRESSLGPTCQIPTRK
KRRKRLERPPELGRQCQISNSVPAIQRAVMPRAGLGLLVCILCSAVRAYPDASPLLNSNL
GGLIHLYTATARNGYHLQIHKDGHVDGTPHQTIYSALMIRSEDSGFVVITGVMSRRYLCM
DFKGNIFGSHHFSPESCRFRQRTLENGYDVYHSPQHFFFVSLGRAKRAFLPGTNPPPYSQ
FLSRRNEIPLFQFNTPRPRRHTRSVEDYKDYDLDPDPLKVLRPSPRWVPALPSCSQELPS
AEDNSVVAKDPSAEDNSVAASDPLGVLRPSRVNIYRERMGKGRCRPHPEFV
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgccttccgtgagcctccgtgaggtctgtgcattttcttcagatgggctgattacaaca
cagaggatgtggacagtggaggttttcctgtttgatgtcacactgctaccctttaaaagg
ctgagggaaaaaaggagggaatccagcctgggacccacatgccagattcccaccaggaag
aagaggagaaaaaggctagagaggccaccagagttggggaggcagtgtcagatttcaaat
tctgtgccagccattcagagagcagtgatgccaagggccggcctagggcttctggtctgc
atcttgtgcagtgcagtcagagcctatcccgatgcctccccactgcttaactccaacttg
gggggcctgatccacctctacacagccacagccaggaatggctaccacctgcagatccac
aaggacggccatgtggatggcacaccccatcagaccatctatagcgctctgatgataaga
tcagaggacagtggctttgtggtgataacaggtgtgatgagtagaagatacctctgcatg
gacttcaaaggcaacatttttggatcacatcacttcagccccgagagctgcaggttccgc
caacgaacgctggagaacggctacgacgtgtatcactcgccccagcacttcttcttcgtc
agcctgggccgagctaagagggccttcctaccgggcacgaaccccccaccttactcccag
ttcctgtcgcgaaggaatgagatccccctgttccagttcaacaccccgcggccacggcgg
cacacgcgcagcgtggaggactacaaagattacgatttggaccccgacccgctgaaagtt
ctgaggcccagtccccggtgggtccctgccttgccctcctgctcccaggagctcccgagt
gccgaagacaatagcgtggtggccaaagacccgagtgctgaggacaacagcgtggcggcc
agcgacccgttaggggtgctcaggcccagcagggtaaacatataccgtgagagaatgggc
aaggggaggtgccgtccccaccctgagttcgtctag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107514447
Entry
107514447         CDS       T06036                                 

Gene name
FGF9
Definition
(RefSeq) fibroblast growth factor 9
  KO
K04358  fibroblast growth factor
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04020  Calcium signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04810  Regulation of actin cytoskeleton
ray05200  Pathways in cancer
ray05218  Melanoma
ray05224  Breast cancer
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107514447 (FGF9)
   04014 Ras signaling pathway
    107514447 (FGF9)
   04015 Rap1 signaling pathway
    107514447 (FGF9)
   04020 Calcium signaling pathway
    107514447 (FGF9)
   04151 PI3K-Akt signaling pathway
    107514447 (FGF9)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107514447 (FGF9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107514447 (FGF9)
  09162 Cancer: specific types
   05226 Gastric cancer
    107514447 (FGF9)
   05218 Melanoma
    107514447 (FGF9)
   05224 Breast cancer
    107514447 (FGF9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107514447 (FGF9)
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107514447 (FGF9)
Cytokines and growth factors [BR:ray04052]
 Growth factors
  Growth factors (RTK binding)
   107514447 (FGF9)
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   107514447 (FGF9)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 107514447
NCBI-ProteinID: XP_016007647
LinkDB
Position
Unknown
AA seq 208 aa
MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGI
LRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNE
KGELFGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKR
HQKFTHFLPRPVDPDKVPELYKDILSQS
NT seq 627 nt   +upstreamnt  +downstreamnt
atggctcccttaggtgaagttggaaactatttcggtgtgcaggatgcagtaccgtttggg
aatgtgcccgtgctgccggtggacagccccgtcttgttaagtgaccacctgggtcagtct
gaagcggggggacttccccggggaccggcggtcacggacttggatcatttaaaggggatt
ctcaggcggaggcagctctactgcaggactggatttcacttggaaatcttccccaacggt
actatccagggaaccaggaaggaccacagccgcttcggcattctggaatttatcagtata
gccgtgggcctggtcagcatccgaggcgtggacagtggcctctacctcgggatgaacgag
aagggggagctgttcggatcggaaaaactaacccaagagtgtgtattcagagaacagttt
gaagaaaactggtataacacgtactcttcgaatctatataaacacgtggacactggaagg
cgatactacgttgcgttaaataaagacgggacccccagagaagggacgaggactaagcgg
caccagaaattcacacattttttacccagaccagtggaccctgacaaagtccccgaactg
tataaggatattctaagccaaagttga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107516440
Entry
107516440         CDS       T06036                                 

Gene name
FGF5
Definition
(RefSeq) fibroblast growth factor 5 isoform X1
  KO
K04358  fibroblast growth factor
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04020  Calcium signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04810  Regulation of actin cytoskeleton
ray05200  Pathways in cancer
ray05218  Melanoma
ray05224  Breast cancer
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107516440 (FGF5)
   04014 Ras signaling pathway
    107516440 (FGF5)
   04015 Rap1 signaling pathway
    107516440 (FGF5)
   04020 Calcium signaling pathway
    107516440 (FGF5)
   04151 PI3K-Akt signaling pathway
    107516440 (FGF5)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107516440 (FGF5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107516440 (FGF5)
  09162 Cancer: specific types
   05226 Gastric cancer
    107516440 (FGF5)
   05218 Melanoma
    107516440 (FGF5)
   05224 Breast cancer
    107516440 (FGF5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107516440 (FGF5)
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107516440 (FGF5)
Cytokines and growth factors [BR:ray04052]
 Growth factors
  Growth factors (RTK binding)
   107516440 (FGF5)
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   107516440 (FGF5)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 107516440
NCBI-ProteinID: XP_016011650
LinkDB
Position
Unknown
AA seq 269 aa
MSLSFLLLFLSHLILSAWAHGEKRLAPKGQSGPSATDRNPGGASSRRSSSTTTSSSSSSA
SSSPSASLGSQGSGLEQSSFQWTPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEASMLS
ILEIFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAIH
RTEKTGREWYVALNKRGKAKRGCSPRVKPQHISTHFLPRFKQSEQPELSFTVTVPEKKKP
PNPIKPKVPLSAPRKSPNTVKYRLKFRFG
NT seq 810 nt   +upstreamnt  +downstreamnt
atgagcttgtccttcctcctcctctttctcagccacctgatcctcagcgcctgggctcac
ggggagaagcgcctcgcccccaaagggcaatccggaccctctgccaccgatagaaacccg
ggaggcgccagcagccgccggagcagcagtaccacgacgtcttcctcttcttcctctgct
tcctcctctccctcggcttctctgggcagccaaggaagcggcttggagcagagcagtttc
cagtggaccccctcggggcgccggaccggcagcctctactgcagagtgggcatcggtttc
catctgcagatctacccagatggcaaagtcaatggctcccacgaagccagtatgttaagt
attttggaaatatttgctgtgtctcaggggattgtaggaatacgaggagttttcagcaac
aaatttttagcgatgtcaaaaaaaggaaaactccatgcaagtgccaaatttacagatgac
tgtaaattcagggaacgatttcaagaaaacagctataatacttatgcctcagcaatacac
agaactgagaaaactggacgggagtggtatgtggccctgaacaaaagagggaaagctaag
agaggctgcagccctcgggtgaaaccccagcacatctctacccacttcctgccaagattc
aagcagtcggagcagccagaactttctttcactgttaccgttcctgagaagaaaaagcca
cccaatcctatcaagccaaaggttcccctttctgcaccccggaaaagccccaacacagtg
aaatacagactcaagtttcgttttggataa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107518501
Entry
107518501         CDS       T06036                                 

Gene name
FGF2
Definition
(RefSeq) LOW QUALITY PROTEIN: fibroblast growth factor 2
  KO
K18497  fibroblast growth factor 2
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04020  Calcium signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04810  Regulation of actin cytoskeleton
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05218  Melanoma
ray05224  Breast cancer
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107518501 (FGF2)
   04014 Ras signaling pathway
    107518501 (FGF2)
   04015 Rap1 signaling pathway
    107518501 (FGF2)
   04020 Calcium signaling pathway
    107518501 (FGF2)
   04151 PI3K-Akt signaling pathway
    107518501 (FGF2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107518501 (FGF2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107518501 (FGF2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107518501 (FGF2)
   05205 Proteoglycans in cancer
    107518501 (FGF2)
  09162 Cancer: specific types
   05226 Gastric cancer
    107518501 (FGF2)
   05218 Melanoma
    107518501 (FGF2)
   05224 Breast cancer
    107518501 (FGF2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    107518501 (FGF2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107518501 (FGF2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107518501 (FGF2)
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107518501 (FGF2)
Cytokines and growth factors [BR:ray04052]
 Growth factors
  Growth factors (RTK binding)
   107518501 (FGF2)
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   107518501 (FGF2)
SSDB
Motif
Pfam: FGF Fascin IL1
Other DBs
NCBI-GeneID: 107518501
NCBI-ProteinID: XP_016015706
LinkDB
Position
Unknown
AA seq 281 aa
MDHFRSMAQGLGTPALDDRWSGHWVSGGLDPRTRRARGLGLRGAAAWGGGLAAHGGGRGF
AAPAAAAPGAGGGAGAQRRRAGARGRGRAPRGAGAGGPGRGRAAERVGGRGRGRGAAAPR
XAPGAAMAAGSITTLPAPPEDVGSGAFPPGHFKDPKRLYCKNGGFFLRIQPDGRVDGVRE
KSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNT
YRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS
NT seq 846 nt   +upstreamnt  +downstreamnt
atggaccacttccggtctatggcccaggggttagggactcctgctctagatgaccggtgg
tctggacactgggtgtcaggtggtctggacccgcggacgcggcgcgcgcgcgggctcggg
ctccggggcgctgcggcgtggggaggcggcctcgctgcgcacggtggcggccgcggattc
gccgcacccgcggcggccgcgcccggggccggcggaggggccggggcccagcggcgcagg
gctggggcccgcgggcgcggccgggcgccgcggggcgcgggggccggggggccggggcgc
ggccgtgccgccgagcgcgtcgggggccggggccggggccggggcgcggcggccccccgc
nnggcgcccggggcggccatggccgccgggagcatcaccacgctgcccgccccgccggag
gacgtcggcagcggcgccttcccgcccggccacttcaaggaccccaagcggctgtactgc
aagaacgggggcttcttcctgcgcatccagcccgacggccgcgtggacggcgtccgcgag
aagagcgacccgcacatcaaactgcagctgcaagcggaggagcgaggggtcgtgtctatc
aagggcgtgtgcgcgaaccgctacctcgccatgaaggaggacgggcggctcctggcttcc
aaatgtgttacggacgagtgtttcttttttgaacgactggagtctaataactacaatact
taccgctcaaggaaatactccagttggtacgtggcactgaagcgaactgggcagtataaa
cttggacccaaaacaggccctgggcagaaagctatactttttcttccaatgtctgcgaag
agctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107518965
Entry
107518965         CDS       T06036                                 

Gene name
FGF10
Definition
(RefSeq) fibroblast growth factor 10
  KO
K04358  fibroblast growth factor
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04020  Calcium signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04810  Regulation of actin cytoskeleton
ray05200  Pathways in cancer
ray05218  Melanoma
ray05224  Breast cancer
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107518965 (FGF10)
   04014 Ras signaling pathway
    107518965 (FGF10)
   04015 Rap1 signaling pathway
    107518965 (FGF10)
   04020 Calcium signaling pathway
    107518965 (FGF10)
   04151 PI3K-Akt signaling pathway
    107518965 (FGF10)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107518965 (FGF10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107518965 (FGF10)
  09162 Cancer: specific types
   05226 Gastric cancer
    107518965 (FGF10)
   05218 Melanoma
    107518965 (FGF10)
   05224 Breast cancer
    107518965 (FGF10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107518965 (FGF10)
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107518965 (FGF10)
Cytokines and growth factors [BR:ray04052]
 Growth factors
  Growth factors (RTK binding)
   107518965 (FGF10)
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   107518965 (FGF10)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 107518965
NCBI-ProteinID: XP_016016604
LinkDB
Position
Unknown
AA seq 213 aa
MWKWILTHCASAFPHLPSCCCCCFLLLFLVSSVPVTCQALGQDMVSPEATNNSSSSSSSS
SFSNPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITS
VEIGVVAVKAVNSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQ
MYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS
NT seq 642 nt   +upstreamnt  +downstreamnt
atgtggaaatggatactgacacattgtgcctcagcctttccccacctgcccagctgctgc
tgctgctgcttcttgttgctgttcttggtgtcttctgtccctgtcacctgccaagccctt
ggtcaggacatggtgtcaccagaggccaccaacaattcctcctcctcttcgtcgtcctcc
tccttctccaatccttccagtgcggggaggcatgtgcggagctacaaccacctccaagga
gatgtccgctggaggaagctattctctttcaccaagtactttctcaagattgagaagaac
gggaaggtcagcggtaccaagaaggagaactgcccgtacagtatcctggagataacttca
gtggaaattggagttgttgccgtcaaagccgttaacagcaactactacttagccatgaac
aagaagggtaaactctacggctccaaagaatttaacaatgactgtaagctgaaggagagg
atagaggaaaatggatacaatacctatgcatcctttaactggcagcacaatgggagacaa
atgtatgtggcattgaatggaaaaggagctcccagaagaggacagaaaacacgaaggaaa
aacacctcagctcattttctcccaatggttgtacactcatag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107520204
Entry
107520204         CDS       T06036                                 

Gene name
PDGFD
Definition
(RefSeq) platelet-derived growth factor D isoform X1
  KO
K05450  platelet derived growth factor C/D
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04020  Calcium signaling pathway
ray04072  Phospholipase D signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04510  Focal adhesion
ray04540  Gap junction
ray04810  Regulation of actin cytoskeleton
ray05215  Prostate cancer
ray05218  Melanoma
ray05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107520204 (PDGFD)
   04014 Ras signaling pathway
    107520204 (PDGFD)
   04015 Rap1 signaling pathway
    107520204 (PDGFD)
   04020 Calcium signaling pathway
    107520204 (PDGFD)
   04072 Phospholipase D signaling pathway
    107520204 (PDGFD)
   04151 PI3K-Akt signaling pathway
    107520204 (PDGFD)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107520204 (PDGFD)
   04540 Gap junction
    107520204 (PDGFD)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107520204 (PDGFD)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    107520204 (PDGFD)
  09162 Cancer: specific types
   05218 Melanoma
    107520204 (PDGFD)
   05215 Prostate cancer
    107520204 (PDGFD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107520204 (PDGFD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107520204 (PDGFD)
Cytokines and growth factors [BR:ray04052]
 Growth factors
  Growth factors (RTK binding)
   107520204 (PDGFD)
SSDB
Motif
Pfam: CUB PDGF
Other DBs
NCBI-GeneID: 107520204
NCBI-ProteinID: XP_016019157
LinkDB
Position
Unknown
AA seq 370 aa
MHRLILVYTLVCANFCSYRDTSAAPQSASIKALRNSNLRRDESNHLTDLYRRDETIQVTG
NGHVQSPRFPNSYPRNLLLTWRLHSQEKTRIQLAFDNQFGLEEAENDICRYDFVEVEDIS
ETSTIIRGRWCGHKEVPPRITSRTNQIKITFKSDDYFVAKPGFKIYYSFVEDFQPAAASE
TNWESVTSSISGVSYHSPSVTDPTLTADALDKTVAEFDTVEDLLKHFNPESWQEDLENLY
LDTPHYRGRSYHDRKPKVDLDRLNDDVKRYSCTPRNYSVYLREELKLTNVVFFPRCLLVQ
RCGGNCGCGTVNWKSCTCNSGKTVKKYHEVLKFEPGYFRRRDRAKHMAVVDIQLDHHERC
DCICSSRPPR
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgcaccgcctcatcctcgtctacactctagtctgcgcaaacttttgcagctaccgggac
acttctgcagctccgcagagcgcatccatcaaagctttgcgcaactccaaccttaggcga
gatgagagcaatcacctcacagacttgtaccgaagagacgaaaccatccaggtgacagga
aatggccatgtgcagagtccccgtttcccaaacagctaccctaggaacctgcttctgacg
tggcggctccactcccaggagaaaacaaggatacagctagcctttgacaaccagtttgga
ttagaagaagcagaaaatgatatctgtaggtatgattttgtggaagtagaagatatatct
gaaaccagtaccattattagaggacgatggtgcggacacaaggaagttcctccaaggata
acatcaagaacaaaccaaattaaaataacattcaagtctgatgactactttgtggctaaa
cctggattcaagatttattattcttttgtggaagatttccaacccgcagcagcctcagag
accaactgggagtcagtcacaagctctatctcaggggtatcctatcactctccatcagta
acggatcccactctcactgcggatgctctggacaaaacagttgcagaattcgatactgtg
gaagatctgctcaagcacttcaatcccgaatcatggcaagaagatcttgagaatctgtat
ttggacacccctcattatcgaggcaggtcataccatgacaggaagccaaaagttgacctg
gacaggctcaatgatgatgtcaagcgttacagttgcactcccaggaattactcggtctac
ttaagagaggagctgaagctgaccaatgtggtcttctttccacgttgtctcctcgtgcag
cgctgtggaggaaattgtggctgtggaactgtcaactggaagtcctgtacatgcaattca
gggaaaaccgtgaaaaaatatcatgaggtattaaagtttgagcctggctatttcaggagg
agggacagagcaaagcacatggctgtcgttgacatccagttggatcaccacgagcggtgc
gattgtatctgcagctccagaccacctcgataa

DBGET integrated database retrieval system