KEGG   Rousettus aegyptiacus (Egyptian rousette): 107497394
Entry
107497394         CDS       T06036                                 

Gene name
PDGFA
Definition
(RefSeq) platelet-derived growth factor subunit A isoform X1
  KO
K04359  platelet-derived growth factor subunit A
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04020  Calcium signaling pathway
ray04072  Phospholipase D signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04510  Focal adhesion
ray04540  Gap junction
ray04630  JAK-STAT signaling pathway
ray04810  Regulation of actin cytoskeleton
ray05200  Pathways in cancer
ray05202  Transcriptional misregulation in cancer
ray05206  MicroRNAs in cancer
ray05214  Glioma
ray05215  Prostate cancer
ray05218  Melanoma
ray05231  Choline metabolism in cancer
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107497394 (PDGFA)
   04014 Ras signaling pathway
    107497394 (PDGFA)
   04015 Rap1 signaling pathway
    107497394 (PDGFA)
   04630 JAK-STAT signaling pathway
    107497394 (PDGFA)
   04020 Calcium signaling pathway
    107497394 (PDGFA)
   04072 Phospholipase D signaling pathway
    107497394 (PDGFA)
   04151 PI3K-Akt signaling pathway
    107497394 (PDGFA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107497394 (PDGFA)
   04540 Gap junction
    107497394 (PDGFA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107497394 (PDGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107497394 (PDGFA)
   05202 Transcriptional misregulation in cancer
    107497394 (PDGFA)
   05206 MicroRNAs in cancer
    107497394 (PDGFA)
   05231 Choline metabolism in cancer
    107497394 (PDGFA)
  09162 Cancer: specific types
   05214 Glioma
    107497394 (PDGFA)
   05218 Melanoma
    107497394 (PDGFA)
   05215 Prostate cancer
    107497394 (PDGFA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107497394 (PDGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107497394 (PDGFA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107497394 (PDGFA)
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107497394 (PDGFA)
Cytokines and growth factors [BR:ray04052]
 Growth factors
  Growth factors (RTK binding)
   107497394 (PDGFA)
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   107497394 (PDGFA)
SSDB
Motif
Pfam: PDGF_N PDGF
Other DBs
NCBI-GeneID: 107497394
NCBI-ProteinID: XP_015974628
LinkDB
Position
Unknown
AA seq 211 aa
MRTWACLLLLGCGYLAHALAEEAEIPREVIERLAHSQIHSIRDLQRLLEIDSVGAEDALG
SSPRAHGGRASKHTPEKRLGPVRRKRSIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIW
PPCVEVRRCTGCCTTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECTCA
AGSPSPDHREEETGRRREAGKKRKRKRLKPT
NT seq 636 nt   +upstreamnt  +downstreamnt
atgaggacctgggcttgcctgctgctgctcggctgcggatacctcgcccatgccctggcc
gaggaagccgagatcccccgcgaggtaattgagaggctggcgcacagtcagatccatagc
atccgggacctccagcgactcctggagatagactccgtaggggccgaggacgctctggga
agcagcccgagagcccacggcggccgcgccagcaagcacacacccgagaagcggctcggg
cccgttcggaggaagagaagcatcgaggaggccgtccccgccgtctgcaagaccaggacg
gtcatctacgagatacctcggagccaggtcgaccccacgtcggccaacttcctgatctgg
cccccgtgcgtggaggtgagacgctgcaccggctgctgcaccaccagcagcgtcaagtgc
cagccctcacgcgtgcaccaccggagcgtcaaggtggccaaggtggagtacgtcaggaag
aagccaaagttaaaagaggtgcaggtgaggctggaggagcacctggagtgcacgtgcgcg
gccggcagcccgagcccggaccaccgcgaggaggagacgggaaggcgtagggaggcaggt
aaaaagcggaaaaggaaaaggttaaagcccacctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107502078
Entry
107502078         CDS       T06036                                 

Gene name
PDGFB
Definition
(RefSeq) platelet-derived growth factor subunit B isoform X1
  KO
K17386  platelet-derived growth factor subunit B
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04020  Calcium signaling pathway
ray04072  Phospholipase D signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04510  Focal adhesion
ray04540  Gap junction
ray04630  JAK-STAT signaling pathway
ray04810  Regulation of actin cytoskeleton
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05200  Pathways in cancer
ray05206  MicroRNAs in cancer
ray05211  Renal cell carcinoma
ray05214  Glioma
ray05215  Prostate cancer
ray05218  Melanoma
ray05231  Choline metabolism in cancer
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107502078 (PDGFB)
   04014 Ras signaling pathway
    107502078 (PDGFB)
   04015 Rap1 signaling pathway
    107502078 (PDGFB)
   04630 JAK-STAT signaling pathway
    107502078 (PDGFB)
   04020 Calcium signaling pathway
    107502078 (PDGFB)
   04072 Phospholipase D signaling pathway
    107502078 (PDGFB)
   04151 PI3K-Akt signaling pathway
    107502078 (PDGFB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107502078 (PDGFB)
   04540 Gap junction
    107502078 (PDGFB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107502078 (PDGFB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107502078 (PDGFB)
   05206 MicroRNAs in cancer
    107502078 (PDGFB)
   05231 Choline metabolism in cancer
    107502078 (PDGFB)
  09162 Cancer: specific types
   05214 Glioma
    107502078 (PDGFB)
   05218 Melanoma
    107502078 (PDGFB)
   05211 Renal cell carcinoma
    107502078 (PDGFB)
   05215 Prostate cancer
    107502078 (PDGFB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107502078 (PDGFB)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    107502078 (PDGFB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107502078 (PDGFB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107502078 (PDGFB)
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107502078 (PDGFB)
Cytokines and growth factors [BR:ray04052]
 Growth factors
  Growth factors (RTK binding)
   107502078 (PDGFB)
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   107502078 (PDGFB)
SSDB
Motif
Pfam: PDGF PDGF_N
Other DBs
NCBI-GeneID: 107502078
NCBI-ProteinID: XP_015984384
LinkDB
Position
Unknown
AA seq 367 aa
MVAATPAFSRGLRPALAPAPGRDGLPRARTGHAQPQSAVPERLAYWARRGCGETGFGHSG
LGRSGGLLRNPALRRCVPAAPPYLRPRPARGITSLPRLQGAERAAWKSLACKGGGLQKRL
QELSGRISPPPLLASRSSELASLPGIQGDPIPEELYEMLSDHSIRSFDDLQRLLHGDSVD
EDGAELDLNLTQSHSGGKSESLSRGRRSLDATTVAEPAMIAECKTRTEVFEISRRLVDRT
NANFLVWPPCVEVQRCSGCCSNRHVQCRPTQVQLRHVQVRKIEIVRKKPSFKKATVTLED
HLACKCETVVAARPVTRSPGSSQEQRAKTPQTRMTIRTVRVRRPPKGKHRKFKHTHDKKV
LKETLGA
NT seq 1104 nt   +upstreamnt  +downstreamnt
atggttgcggccacgccggccttcagcagaggtctgcgtcccgccctggctcccgctccc
ggtcgggatgggctccctcgggcccgcacagggcatgcccagccccagagcgcggtcccg
gagcggctggcgtattgggcgcggcgcgggtgcggagagacaggcttcgggcactcggga
ttagggaggagtggggggctcttaaggaatccagccctaaggcggtgtgtgcctgcggcc
ccgccatacctgcgcccgcgccctgcgagaggaatcacctctctccctcgcttgcagggt
gcggagcgcgccgcctggaaaagcctggcttgcaagggaggtgggctacaaaaacgtctg
caggagctctcgggtcggatcagtcccccgcccctcctagcctcacgtagcagtgagttg
gcaagtctacccggaatccagggagaccccatccccgaggagctctacgagatgctgagt
gaccactctatccgctccttcgatgacctccagcgcctgctgcacggagactccgtagat
gaagatggggctgaattggacctgaatttgacccagtcccattccggaggcaagtcagag
agcttatcccgagggagaaggagcctagacgccacgacggtcgccgagccagccatgatc
gccgagtgcaagacccgcaccgaggtgttcgagatctcccggcgcctcgtcgaccgcacc
aacgccaacttcctggtgtggccgccctgcgtggaggtgcagcgctgctccggctgctgc
agcaaccgccacgtgcagtgccgccccacccaggtgcagctgcgccacgtccaggtgaga
aagatcgagattgtgcggaagaagccgagctttaagaaggccacagtgaccctggaggac
cacctggcatgcaagtgtgagacggtggtggccgcaagacctgtgacccgaagcccaggg
agttcccaggagcagcgagccaagacgccccaaactcggatgaccatcaggacagtgcga
gtccgccggccccccaaggggaagcacaggaagttcaagcacacgcatgacaagaaggtg
ctgaaggagacccttggagcctag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107507553
Entry
107507553         CDS       T06036                                 

Gene name
PDGFC
Definition
(RefSeq) platelet-derived growth factor C isoform X1
  KO
K05450  platelet derived growth factor C/D
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04020  Calcium signaling pathway
ray04072  Phospholipase D signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04510  Focal adhesion
ray04540  Gap junction
ray04810  Regulation of actin cytoskeleton
ray05215  Prostate cancer
ray05218  Melanoma
ray05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107507553 (PDGFC)
   04014 Ras signaling pathway
    107507553 (PDGFC)
   04015 Rap1 signaling pathway
    107507553 (PDGFC)
   04020 Calcium signaling pathway
    107507553 (PDGFC)
   04072 Phospholipase D signaling pathway
    107507553 (PDGFC)
   04151 PI3K-Akt signaling pathway
    107507553 (PDGFC)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107507553 (PDGFC)
   04540 Gap junction
    107507553 (PDGFC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107507553 (PDGFC)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    107507553 (PDGFC)
  09162 Cancer: specific types
   05218 Melanoma
    107507553 (PDGFC)
   05215 Prostate cancer
    107507553 (PDGFC)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107507553 (PDGFC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107507553 (PDGFC)
Cytokines and growth factors [BR:ray04052]
 Growth factors
  Growth factors (RTK binding)
   107507553 (PDGFC)
SSDB
Motif
Pfam: CUB PDGF
Other DBs
NCBI-GeneID: 107507553
NCBI-ProteinID: XP_015994155
LinkDB
Position
Unknown
AA seq 345 aa
MLLFGLLLLTSALAGQRHGTQAESNLSSKFQFSSNKEQNGVQDSQHERIVTVSTNGSIHS
PKFPHTYPRNMVLVWRLVAAEENVWIQLTFDERFGLEDPEDDICKYDFVEVEDPSDGTVL
GRWCGSGTVPGKQISKGNQIRIRFVSDEYFPSEPGFCIHYNVVMPQFTEAVSPSVLPPSA
LPLDLLNNAVAAFSTLEDLIRYLEPDRWQLDLEDLYRPTWQLLGKAFVFGRKSRVVDLNL
LKEEVRLYSCTPRNFSVSVREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSK
VTKKYHEVLQLRPKVGVRGLHKSLTDVALEHHEECDCVCRGNAGG
NT seq 1038 nt   +upstreamnt  +downstreamnt
atgctcctcttcgggcttctcctgctgacatccgccctggccggccagagacacgggact
caggctgagtccaacctgagtagtaaattccagttctccagcaacaaggaacagaacggg
gtacaagattcccagcatgagagaattgttactgtgtctactaatggaagtattcacagc
ccaaagtttcctcatacttatccaagaaatatggtcttggtgtggagattagtagcggca
gaggaaaatgtatggatacagcttacatttgatgaaagatttgggcttgaagacccagaa
gatgacatatgcaagtatgattttgtagaagttgaggaccccagtgatggaactgtatta
gggcgctggtgtggctctgggactgtgccaggaaaacagatttctaaaggaaatcaaatc
aggataagatttgtatctgatgaatattttccttctgaaccaggtttctgcatccactat
aatgttgtcatgccacagttcacagaagctgtgagtccttccgtgttacccccctcagct
ttgccactggacctgcttaataacgctgtcgctgcctttagtaccttggaagaccttatt
cggtatcttgaaccagataggtggcagttggacttagaagatctatacaggccaacttgg
caacttcttggcaaggcttttgtttttggaagaaaatccagagtagtggatctgaacctt
ctaaaagaggaggtaagattatacagctgcacacctcgtaacttctcggtgtctgtaagg
gaagaactaaagagaaccgataccattttctggccaggttgtctcctggttaaacgctgt
ggtggaaactgtgcctgttgtctccacaactgcaatgaatgtcaatgtgtcccaagcaaa
gttactaaaaaatatcatgaggtccttcagttgagaccaaaggttggtgtcagggggttg
cacaaatctctcactgacgtggccctcgagcaccacgaggagtgtgactgtgtgtgcaga
gggaacgcgggaggataa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107508819
Entry
107508819         CDS       T06036                                 

Gene name
EGF
Definition
(RefSeq) pro-epidermal growth factor isoform X1
  KO
K04357  epidermal growth factor
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray04010  MAPK signaling pathway
ray04012  ErbB signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04020  Calcium signaling pathway
ray04066  HIF-1 signaling pathway
ray04068  FoxO signaling pathway
ray04072  Phospholipase D signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04510  Focal adhesion
ray04540  Gap junction
ray04630  JAK-STAT signaling pathway
ray04810  Regulation of actin cytoskeleton
ray05160  Hepatitis C
ray05165  Human papillomavirus infection
ray05200  Pathways in cancer
ray05210  Colorectal cancer
ray05212  Pancreatic cancer
ray05213  Endometrial cancer
ray05214  Glioma
ray05215  Prostate cancer
ray05218  Melanoma
ray05219  Bladder cancer
ray05223  Non-small cell lung cancer
ray05224  Breast cancer
ray05226  Gastric cancer
ray05231  Choline metabolism in cancer
ray05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107508819 (EGF)
   04012 ErbB signaling pathway
    107508819 (EGF)
   04014 Ras signaling pathway
    107508819 (EGF)
   04015 Rap1 signaling pathway
    107508819 (EGF)
   04630 JAK-STAT signaling pathway
    107508819 (EGF)
   04066 HIF-1 signaling pathway
    107508819 (EGF)
   04068 FoxO signaling pathway
    107508819 (EGF)
   04020 Calcium signaling pathway
    107508819 (EGF)
   04072 Phospholipase D signaling pathway
    107508819 (EGF)
   04151 PI3K-Akt signaling pathway
    107508819 (EGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107508819 (EGF)
   04540 Gap junction
    107508819 (EGF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107508819 (EGF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107508819 (EGF)
   05231 Choline metabolism in cancer
    107508819 (EGF)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107508819 (EGF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107508819 (EGF)
   05212 Pancreatic cancer
    107508819 (EGF)
   05226 Gastric cancer
    107508819 (EGF)
   05214 Glioma
    107508819 (EGF)
   05218 Melanoma
    107508819 (EGF)
   05219 Bladder cancer
    107508819 (EGF)
   05215 Prostate cancer
    107508819 (EGF)
   05213 Endometrial cancer
    107508819 (EGF)
   05224 Breast cancer
    107508819 (EGF)
   05223 Non-small cell lung cancer
    107508819 (EGF)
  09172 Infectious disease: viral
   05160 Hepatitis C
    107508819 (EGF)
   05165 Human papillomavirus infection
    107508819 (EGF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107508819 (EGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107508819 (EGF)
Cytokines and growth factors [BR:ray04052]
 Growth factors
  Growth factors (RTK binding)
   107508819 (EGF)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition cEGF EGF_CA DUF5050 EGF EGF_3 Tr-sialidase_C
Other DBs
NCBI-GeneID: 107508819
NCBI-ProteinID: XP_015996313
LinkDB
Position
Unknown
AA seq 1124 aa
MLLFLVILLPVVFKSGFVSLSALPRWNCPEESPSGNGNPACVGPAPFLIFSHGNSIFRID
LEGTNYEKLVTDAGVSVIMDFHYNKERIYWVDLERQLLQRVFLNGTRQERVCNIEKNVSG
MAINWINEELIWSNQQEGIITITDMKGNNSRVLLSALKYPANVAVDPVERFIFWSSEVAG
SLQRTDLSGVEVKILVETAEKITAMSLDVLDKRLFWVQYDREGSNSRICSCDYDGGSVHF
SKYLSQHNLFSISLFGDRIFYSTWRKKTIWIANKHTGKDIVRINLNASFVPPGGIKVVHL
IGQPRAEDDAWASDQNFCRLRKGNCRGSVCGQDLKSHSCTCAEGYALSQDGKYCEDVNEC
AFWNHGCTLGCENIPGSYYCTCPVGFVLLPDGKRCHQLISCPSNASECSHECVLTSDGPI
CFCPEGSVLGTDGKTCSGCSSPDNGGCSQLCIPLSPVSWECGCYPGYDLRLDKKSCAASG
PQPFLLFANSQDIRHMHFDGTDYGTLLSKQMGTVFAIDHDPVENKVYFAHTALKCIERAN
MDGSQRERLIEEAIDVPEGLAIDWINRKLYWTDRGKSVIEGSDLSGKHREIIIKEDISRP
RGIAVHPVAKRLFWTDMGINPRIESSSLQGFGRLVIASSELVWPSGITIDFLTDKLYWCD
AKQSVIEMANLDGSKRQRLAQNDVGRPFAVAVFEDYIWFSDWTVPSVIRVNKRTGKNRVR
LRGSMLKPSSLVVVHPLAKPGADPCLYRNGGCEHICKEKFGTVQCSCREGFVKAPDGKLC
LALNGHQIAAGSGTDLSNQVKPSDILLSSQGFEDNITESQHVLVSEIMASDDDDCGPMGC
GAHSQCVSEGEVATCQCLKGFAGDGKLCSDIDECEMDVTVCPHPSSKCINTEGGHVCQCS
QGYQGDGIHCLDIDECQLGMHTCGENATCTNAEGNYTCLCAGIPSEPGRICPDSTPPSHL
REDGHYSVRNSYSECPPSHAGYCLHDGVCMYIEAVDNYACNCIVGYVGERCQHRDLKWWE
LRHAGHGRQRSLAVGAVCVLVLVLLLLLGLWGAHCYRTQKLLSKNQKSPYEESCRDPSIS
RPADGEARVSSCPQPWFVVIKEHENLRNGDPPVAPRDGQAAVAD
NT seq 3375 nt   +upstreamnt  +downstreamnt
atgctgctcttccttgtcattctgttgccggtagtttttaagtctggttttgttagtctc
tcagcactgcctcgctggaactgtcctgaagagtctccctctggaaatgggaatcctgct
tgtgtgggtcctgcacccttcttaattttctctcatggaaatagtatctttaggattgac
ctggaaggaactaattatgagaaattggtgacagatgctggcgtatcagtgatcatggat
tttcattacaataaggaaagaatctattgggtagatctagaaagacaacttttgcaaaga
gtttttctgaatgggacaaggcaagagagagtatgcaatatagagaaaaatgtttcagga
atggcaataaattggataaatgaagaacttatttggtcaaatcaacaggaaggaatcatt
acaataacagatatgaaaggaaacaattcccgtgttctcttaagtgccttaaaatatcct
gcaaatgtagcggttgatccagtagaaaggtttatattttggtcttcagaggtggccggc
agccttcagaggacagatctcagtggtgtggaagtgaagattctggtagagacggcagag
aaaataacagctatgtcgttggatgtgcttgataaacggctcttttgggttcagtatgac
agagaaggaagcaattctcgtatttgttcctgtgattatgatggaggttctgtccatttt
agtaaatatctttcacagcacaatttgttttcaatatccctttttggtgaccgaatcttc
tattcaacatggagaaagaagacaatttggatagctaacaaacacactgggaaggatata
gttcgaattaacctcaatgcatcatttgtaccacctggaggaattaaagtagtgcacctg
atcggacagcccagggcagaggatgatgcttgggcatctgatcagaacttctgcagactg
aggaaaggcaactgcagaggcagcgtgtgtgggcaagaccttaagtcccattcgtgcacg
tgtgcggagggatatgctttaagccaggacggaaagtattgtgaagatgttaatgaatgt
gctttttggaaccatggctgcactcttggatgcgaaaacatccctggatcctattattgc
acatgccctgtaggatttgttctgcttcctgatggaaaacggtgtcaccaattaatttcc
tgtccaagcaatgcatctgaatgcagccatgagtgcgttctgacttcagatggtcccata
tgtttctgtcctgaaggttcagtgcttgggacagatggaaaaacgtgtagtggctgttca
tcacctgataatggtggatgtagccagctctgcatccctctcagcccagtatcctgggaa
tgtggttgctaccctggttatgacctacgactggacaaaaaaagctgtgcagcttcagga
ccacaaccatttttgctgtttgccaattctcaagatattcgacacatgcattttgatgga
acagattatggaaccctgctcagcaagcaaatgggaacggttttcgccatagatcatgac
cctgtggaaaataaggtatactttgcccatacagccctcaagtgcatagagagagcaaat
atggatggttcccagagagaaaggcttatcgaggaagcaatagatgtgccagaaggtctt
gctatagactggatcaatcgtaaactctattggacagacagagggaaatcggtcattgaa
ggcagtgatttaagtggaaaacatcgtgaaataatcattaaggaagacatctctcggcca
cgaggaattgctgtccatccagtggccaagagattattctggactgatatgggaattaat
ccacgaattgaaagttcttccctccaaggctttggccgactggtcatcgctagctctgag
ctggtctggcccagtggaataacgattgacttcctaaccgacaagttgtattggtgcgat
gccaagcaatctgtgattgaaatggctaatctggatggttcgaaacgccaaagacttgcc
cagaacgatgtaggtcgcccctttgctgtggctgtgtttgaggattacatctggttctcc
gactggactgtgccctcggtaataagagtgaacaagaggactggcaaaaacagggtacgt
ctccgaggcagcatgctgaagccctcatcactggttgtagttcatccattggcaaaacca
ggagcagatccctgcttatatcgaaatggaggctgtgaacatatttgcaaagagaagttt
ggaactgttcagtgttcgtgtcgtgaaggttttgtgaaagccccagatgggaaactgtgt
ctggccctaaatggtcatcagatagcggcaggtagtggaacagatctaagtaatcaagta
aaaccatcggacatcttactcagcagtcaagggtttgaagataatattacagaatcgcaa
catgtgctagtgtctgaaatcatggcatcagatgatgacgactgtggtcccatggggtgt
ggtgcacactctcagtgtgtttcagagggagaggtggccacgtgtcagtgtttgaaagga
tttgctggggatggaaaattatgttctgatatagatgaatgtgagatggatgttacagtt
tgcccgcacccctcctccaagtgcatcaatactgaaggtggccatgtctgccagtgctca
caaggctaccaaggagacggaattcactgtctcgatattgatgagtgccaactgggcatg
cacacctgtggggaaaatgccacctgtacaaacgcagagggaaactacacctgcctgtgt
gccggcatcccgtctgaacctggacggatttgccctgactccactccaccctctcatctc
agggaagatggtcactattctgtgaggaatagttactccgaatgtcccccgtcccacgct
gggtactgcctccacgacggtgtgtgcatgtacattgaagccgtggacaactacgcatgc
aactgtattgttggctacgtcggggagcgatgtcagcaccgagacttgaaatggtgggaa
ctgcgccacgctggccacgggcggcagcggagcctggcggtgggggccgtctgcgtcctg
gtgctcgtcctgctgctgctcctggggctgtggggcgcgcactgctacaggactcagaag
ctgctatcaaaaaatcagaagagcccttacgaagagtcatgcagagatccgagcatcagc
aggcctgcagacggagaggccagggtgtcctcctgtccccagccttggtttgtggttata
aaggaacacgagaacctcaggaatggggatccacccgtggctccccgggatggccaggcc
gcagttgctgactag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107520204
Entry
107520204         CDS       T06036                                 

Gene name
PDGFD
Definition
(RefSeq) platelet-derived growth factor D isoform X1
  KO
K05450  platelet derived growth factor C/D
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04020  Calcium signaling pathway
ray04072  Phospholipase D signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04510  Focal adhesion
ray04540  Gap junction
ray04810  Regulation of actin cytoskeleton
ray05215  Prostate cancer
ray05218  Melanoma
ray05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107520204 (PDGFD)
   04014 Ras signaling pathway
    107520204 (PDGFD)
   04015 Rap1 signaling pathway
    107520204 (PDGFD)
   04020 Calcium signaling pathway
    107520204 (PDGFD)
   04072 Phospholipase D signaling pathway
    107520204 (PDGFD)
   04151 PI3K-Akt signaling pathway
    107520204 (PDGFD)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107520204 (PDGFD)
   04540 Gap junction
    107520204 (PDGFD)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107520204 (PDGFD)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    107520204 (PDGFD)
  09162 Cancer: specific types
   05218 Melanoma
    107520204 (PDGFD)
   05215 Prostate cancer
    107520204 (PDGFD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107520204 (PDGFD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107520204 (PDGFD)
Cytokines and growth factors [BR:ray04052]
 Growth factors
  Growth factors (RTK binding)
   107520204 (PDGFD)
SSDB
Motif
Pfam: CUB PDGF
Other DBs
NCBI-GeneID: 107520204
NCBI-ProteinID: XP_016019157
LinkDB
Position
Unknown
AA seq 370 aa
MHRLILVYTLVCANFCSYRDTSAAPQSASIKALRNSNLRRDESNHLTDLYRRDETIQVTG
NGHVQSPRFPNSYPRNLLLTWRLHSQEKTRIQLAFDNQFGLEEAENDICRYDFVEVEDIS
ETSTIIRGRWCGHKEVPPRITSRTNQIKITFKSDDYFVAKPGFKIYYSFVEDFQPAAASE
TNWESVTSSISGVSYHSPSVTDPTLTADALDKTVAEFDTVEDLLKHFNPESWQEDLENLY
LDTPHYRGRSYHDRKPKVDLDRLNDDVKRYSCTPRNYSVYLREELKLTNVVFFPRCLLVQ
RCGGNCGCGTVNWKSCTCNSGKTVKKYHEVLKFEPGYFRRRDRAKHMAVVDIQLDHHERC
DCICSSRPPR
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgcaccgcctcatcctcgtctacactctagtctgcgcaaacttttgcagctaccgggac
acttctgcagctccgcagagcgcatccatcaaagctttgcgcaactccaaccttaggcga
gatgagagcaatcacctcacagacttgtaccgaagagacgaaaccatccaggtgacagga
aatggccatgtgcagagtccccgtttcccaaacagctaccctaggaacctgcttctgacg
tggcggctccactcccaggagaaaacaaggatacagctagcctttgacaaccagtttgga
ttagaagaagcagaaaatgatatctgtaggtatgattttgtggaagtagaagatatatct
gaaaccagtaccattattagaggacgatggtgcggacacaaggaagttcctccaaggata
acatcaagaacaaaccaaattaaaataacattcaagtctgatgactactttgtggctaaa
cctggattcaagatttattattcttttgtggaagatttccaacccgcagcagcctcagag
accaactgggagtcagtcacaagctctatctcaggggtatcctatcactctccatcagta
acggatcccactctcactgcggatgctctggacaaaacagttgcagaattcgatactgtg
gaagatctgctcaagcacttcaatcccgaatcatggcaagaagatcttgagaatctgtat
ttggacacccctcattatcgaggcaggtcataccatgacaggaagccaaaagttgacctg
gacaggctcaatgatgatgtcaagcgttacagttgcactcccaggaattactcggtctac
ttaagagaggagctgaagctgaccaatgtggtcttctttccacgttgtctcctcgtgcag
cgctgtggaggaaattgtggctgtggaactgtcaactggaagtcctgtacatgcaattca
gggaaaaccgtgaaaaaatatcatgaggtattaaagtttgagcctggctatttcaggagg
agggacagagcaaagcacatggctgtcgttgacatccagttggatcaccacgagcggtgc
gattgtatctgcagctccagaccacctcgataa

DBGET integrated database retrieval system