KEGG   Rousettus aegyptiacus (Egyptian rousette): 107497410
Entry
107497410         CDS       T06036                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase, inducible isoform X1
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00220  Arginine biosynthesis
ray00330  Arginine and proline metabolism
ray01100  Metabolic pathways
ray04020  Calcium signaling pathway
ray04066  HIF-1 signaling pathway
ray04146  Peroxisome
ray04371  Apelin signaling pathway
ray04926  Relaxin signaling pathway
ray05010  Alzheimer disease
ray05014  Amyotrophic lateral sclerosis
ray05022  Pathways of neurodegeneration - multiple diseases
ray05133  Pertussis
ray05140  Leishmaniasis
ray05142  Chagas disease
ray05145  Toxoplasmosis
ray05146  Amoebiasis
ray05152  Tuberculosis
ray05200  Pathways in cancer
ray05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    107497410 (NOS2)
   00330 Arginine and proline metabolism
    107497410 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107497410 (NOS2)
   04066 HIF-1 signaling pathway
    107497410 (NOS2)
   04020 Calcium signaling pathway
    107497410 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    107497410 (NOS2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    107497410 (NOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107497410 (NOS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    107497410 (NOS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107497410 (NOS2)
   05014 Amyotrophic lateral sclerosis
    107497410 (NOS2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    107497410 (NOS2)
   05152 Tuberculosis
    107497410 (NOS2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107497410 (NOS2)
   05145 Toxoplasmosis
    107497410 (NOS2)
   05140 Leishmaniasis
    107497410 (NOS2)
   05142 Chagas disease
    107497410 (NOS2)
Enzymes [BR:ray01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     107497410 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 107497410
NCBI-ProteinID: XP_015974666
LinkDB
Position
Unknown
AA seq 1148 aa
MTGWQKGYSEIPLCPQILHLMIAVSFHSPVTQDDTKRHSLGKHQNEGPQPFLGTVKKSPE
SPVKLGAPPSACPRHMRIKNWGSGVTFQDTLHHKAKGDLACKSKCCLGAIMNPKSLTRGP
RDKPTSPEELLPQAIEFVNQYYSSFKESKIEEHLARVEAVTKEIETTGTYRLTGDELIFA
TKQAWRNAPRCIGRIQWSNLQVFDARSCSTAQEMFEHICRHLRYATNNGNIRSAITVFPQ
RSDGKHDFRIWNSQLIRYAGYQMPDGTVRGDRACVEFTQLCIDLGWKPKYGRFDVLPLVL
QADGHDPEFFEIPSDLVLEVPMEHPKYEWFQELELKWYALPAVSNMLLEVGGLEFPGCPF
NGWYMGTEIGVRDFCDVQRYNILEEVGRRMGLETHKLTSLWKDQAVIEINVAVLHSFQKQ
NVTIMDHHSAAESFMKYMQNEYRSRGGCPADWVWLVPPISGSITPVFHQEMLNYVLSPFY
YYQVEPWKTHVWQDEKRRPQRREIRFQVLVKAVLFTSMLMHKTMASRVRATVLFATETGK
SETLARDLGALFSRAFNPKVLCMDEYRLSSLEEEQLLLVVTSTFGNGDSPGNGEKLKKSL
LMLKELTNKFRYAVFGLGSSMYPQFCAFAHDIDQKLSHLGASQLTPTGEGDELSGQEEAF
RSWAVQTFKAACETFNIRGKQHIQIPKLYTTNVTWDPHHYRLVQDPQPLDLNKALSSMHA
KNVFTLKLKSQQNLQSLKSSRTTLLVELSCEGSQGLSYLPGEHLGVFPSNQLALVQGILE
RVVDSPAPHQSMRLENLSETGSYWVRDKRLPPCSLSQALTYFLDITTPPTQLLLRKLAQL
ALEETDRQKLETLCQPSEYNKWKFTNSPTFLEVLEEFPSLRVSATFLLSQLPILKPRYYS
ISSSRDHTPTEVHLTVAVLTYRTRDGQGPLHHGVCSTWLSSLKPQDPVPCFVRSASGFQL
PEDPSHPCILIGPGTGIAPFRSFWQQRLHDAEHKGLQGGRMILLFGCRRPDEDHLYQEEM
LEMARKGVLHGVHTAYSRLPGQPKVYVQDILRQRLAGEVLRVLHEEQGHLYVCGDVRMAR
DVAHTLKKLVAAKLSLSEEQVEDYFFQLKSQKRYHEDIFGAAFPYEAKKDGAAGQPSNIR
APTDQRRI
NT seq 3447 nt   +upstreamnt  +downstreamnt
atgacaggctggcagaagggttactccgagatccctctctgccctcagatactccatctc
atgatagctgtttcctttcacagtccagtgacgcaggatgacaccaagcgccacagcctc
ggcaagcaccagaatgagggcccccagcccttcctggggacagtaaagaagtctccagaa
tccccggtcaagctgggtgcacccccatcggcctgcccacggcacatgaggatcaaaaac
tggggcagtggggtgactttccaagatacacttcaccacaaggccaaaggggatcttgct
tgcaagtccaagtgttgcctgggagccatcatgaaccccaaaagtttgaccagaggacct
agggacaagcctacctccccagaagagcttctacctcaagctatcgagtttgtcaaccag
tattatagctccttcaaagagtcaaaaatagaggaacatctggctagggtggaagcagtg
acaaaggagatagaaacaacaggaacctaccggctgacaggagatgagctcatctttgcc
accaagcaggcctggcgcaatgctccccgctgcatcgggaggatccagtggtccaaccta
caggtcttcgacgcccggagctgttccactgcccaggaaatgttcgagcatatctgcaga
cacctgcgctatgccaccaacaacggcaacatcaggtcggccatcaccgtgttccctcag
cggagtgatgggaaacacgacttccggatctggaactcgcagctcatccggtatgctggt
taccagatgcctgatggtaccgtcagaggggaccgtgcctgcgtggagttcacccagctg
tgcattgacctgggctggaagccgaagtacggccgcttcgatgtgttgcctctggtcctg
caggctgatggccatgaccctgaattctttgaaatcccgtctgaccttgtactcgaggtg
cccatggaacatcccaagtacgaatggttccaggaactggagctcaagtggtatgccctg
cctgcagtgtccaatatgttgcttgaggtgggtggccttgagttcccagggtgccccttc
aacggctggtacatgggcacagagatcggggtccgggacttctgtgacgtccagcgctac
aacatcctggaggaagtgggcagaaggatgggcctagaaacacacaagttgacctctctc
tggaaagaccaggctgtcattgagatcaatgtcgctgtgctccacagtttccagaagcaa
aacgtgaccatcatggatcaccactctgctgcagagtcattcatgaagtacatgcagaat
gagtaccggtcccgagggggctgcccagctgactgggtttggctggtccccccaatttct
ggaagcatcacccccgtgttccaccaggagatgttaaactatgttctgtcccctttctac
tactaccaggtggagccctggaaaacccacgtctggcaggatgagaagcggagaccccag
agaagagagattcgattccaagtcttggttaaagccgtgctcttcacctccatgctgatg
cacaagactatggcatcccgggtcagagccacagtcctttttgcaacggagacaggaaaa
tcagaaaccttggcccgggacctaggcgccttgttcagccgtgccttcaaccccaaggtt
ctctgcatggatgagtacaggctgagcagcctggaggaggagcagctgcttctggtggtg
accagtacatttgggaatggagactcccccggcaacggagagaaactgaagaaatccctc
ctcatgctgaaagagctcaccaacaagttcaggtatgccgtgtttggcctcggttccagc
atgtatcctcagttctgcgcctttgctcatgacatcgaccagaagttgtctcacctggga
gcctctcagctcaccccaacaggggaaggggatgaactcagtgggcaggaggaagccttc
cgcagctgggccgtgcaaaccttcaaggcagcctgtgagacgttcaacatccgaggcaaa
cagcacattcagatccccaagctctacactaccaatgtaacctgggacccgcaccactac
aggcttgtgcaggacccacagcctttggacctcaacaaagcactcagcagtatgcacgcc
aagaatgtgttcaccttgaagctcaaatcgcagcagaatctacagagtctgaagtccagc
cgcaccaccctcctggtggaactctcctgtgagggcagccaaggtctcagctacctgccc
ggagagcacctgggggttttcccaagcaaccagctggccctggtccaaggcattttggag
cgagtggtggacagccctgcaccccaccaatccatgcgcctggagaacctcagtgagacc
ggcagctactgggtcagggacaagcggctgcccccctgctcactcagccaagccctcacc
tacttcctggatatcaccaccccaccaacccaactgctgctccgaaagctggcccagttg
gccctggaagagaccgataggcagaagctagaaacactgtgccagccctcggaatataat
aagtggaagttcaccaacagccccacgttcttggaggtgctagaggagttcccatccctg
cgggtgtctgccaccttcctgctctcccagctccctattctgaaaccgcggtactactcc
atcagctcctccagggaccacacacccacggaggtccacctcacggtggccgtgctcacc
taccgcacccgagatggccagggtcccctacaccacggtgtctgcagcacatggcttagc
agcctgaagccccaagacccagtgccttgctttgtaagaagtgccagtggcttccagctt
cctgaggacccctcccatccctgcatcctcatcgggcctggcacgggcatcgctcccttc
cgcagtttttggcagcagcggctccatgatgctgagcacaaagggctccagggcggccgc
atgatcctgttgtttgggtgccggcgcccagatgaggaccacctctatcaggaggagatg
ctggagatggcccggaagggggtgctgcatggggtgcacacagcctactctcgcctgcct
ggccagcccaaggtctatgttcaagacatcctgcggcagcggctggctggtgaggtgctt
cgcgtgctccatgaggagcaaggccacctctatgtctgcggggacgtgcgcatggcccgg
gatgtggcccacaccctgaagaagctggtggctgccaaactgagcctgagtgaggagcag
gtcgaggactatttcttccagcttaagagccagaagcgctatcatgaagatatctttggt
gctgcatttccctatgaggcaaaaaaggatggggcagccgggcagcccagtaatatcaga
gcgccaacagaccagaggagaatttaa

DBGET integrated database retrieval system