KEGG   Rousettus aegyptiacus (Egyptian rousette): 107497410
Entry
107497410         CDS       T06036                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase, inducible isoform X1
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00220  Arginine biosynthesis
ray00330  Arginine and proline metabolism
ray01100  Metabolic pathways
ray04020  Calcium signaling pathway
ray04066  HIF-1 signaling pathway
ray04146  Peroxisome
ray04371  Apelin signaling pathway
ray04926  Relaxin signaling pathway
ray05010  Alzheimer disease
ray05014  Amyotrophic lateral sclerosis
ray05022  Pathways of neurodegeneration - multiple diseases
ray05133  Pertussis
ray05140  Leishmaniasis
ray05142  Chagas disease
ray05145  Toxoplasmosis
ray05146  Amoebiasis
ray05152  Tuberculosis
ray05200  Pathways in cancer
ray05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    107497410 (NOS2)
   00330 Arginine and proline metabolism
    107497410 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107497410 (NOS2)
   04066 HIF-1 signaling pathway
    107497410 (NOS2)
   04020 Calcium signaling pathway
    107497410 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    107497410 (NOS2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    107497410 (NOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107497410 (NOS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    107497410 (NOS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107497410 (NOS2)
   05014 Amyotrophic lateral sclerosis
    107497410 (NOS2)
   05022 Pathways of neurodegeneration - multiple diseases
    107497410 (NOS2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    107497410 (NOS2)
   05152 Tuberculosis
    107497410 (NOS2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107497410 (NOS2)
   05145 Toxoplasmosis
    107497410 (NOS2)
   05140 Leishmaniasis
    107497410 (NOS2)
   05142 Chagas disease
    107497410 (NOS2)
Enzymes [BR:ray01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     107497410 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 107497410
NCBI-ProteinID: XP_015974666
LinkDB
Position
Unknown
AA seq 1148 aa
MTGWQKGYSEIPLCPQILHLMIAVSFHSPVTQDDTKRHSLGKHQNEGPQPFLGTVKKSPE
SPVKLGAPPSACPRHMRIKNWGSGVTFQDTLHHKAKGDLACKSKCCLGAIMNPKSLTRGP
RDKPTSPEELLPQAIEFVNQYYSSFKESKIEEHLARVEAVTKEIETTGTYRLTGDELIFA
TKQAWRNAPRCIGRIQWSNLQVFDARSCSTAQEMFEHICRHLRYATNNGNIRSAITVFPQ
RSDGKHDFRIWNSQLIRYAGYQMPDGTVRGDRACVEFTQLCIDLGWKPKYGRFDVLPLVL
QADGHDPEFFEIPSDLVLEVPMEHPKYEWFQELELKWYALPAVSNMLLEVGGLEFPGCPF
NGWYMGTEIGVRDFCDVQRYNILEEVGRRMGLETHKLTSLWKDQAVIEINVAVLHSFQKQ
NVTIMDHHSAAESFMKYMQNEYRSRGGCPADWVWLVPPISGSITPVFHQEMLNYVLSPFY
YYQVEPWKTHVWQDEKRRPQRREIRFQVLVKAVLFTSMLMHKTMASRVRATVLFATETGK
SETLARDLGALFSRAFNPKVLCMDEYRLSSLEEEQLLLVVTSTFGNGDSPGNGEKLKKSL
LMLKELTNKFRYAVFGLGSSMYPQFCAFAHDIDQKLSHLGASQLTPTGEGDELSGQEEAF
RSWAVQTFKAACETFNIRGKQHIQIPKLYTTNVTWDPHHYRLVQDPQPLDLNKALSSMHA
KNVFTLKLKSQQNLQSLKSSRTTLLVELSCEGSQGLSYLPGEHLGVFPSNQLALVQGILE
RVVDSPAPHQSMRLENLSETGSYWVRDKRLPPCSLSQALTYFLDITTPPTQLLLRKLAQL
ALEETDRQKLETLCQPSEYNKWKFTNSPTFLEVLEEFPSLRVSATFLLSQLPILKPRYYS
ISSSRDHTPTEVHLTVAVLTYRTRDGQGPLHHGVCSTWLSSLKPQDPVPCFVRSASGFQL
PEDPSHPCILIGPGTGIAPFRSFWQQRLHDAEHKGLQGGRMILLFGCRRPDEDHLYQEEM
LEMARKGVLHGVHTAYSRLPGQPKVYVQDILRQRLAGEVLRVLHEEQGHLYVCGDVRMAR
DVAHTLKKLVAAKLSLSEEQVEDYFFQLKSQKRYHEDIFGAAFPYEAKKDGAAGQPSNIR
APTDQRRI
NT seq 3447 nt   +upstreamnt  +downstreamnt
atgacaggctggcagaagggttactccgagatccctctctgccctcagatactccatctc
atgatagctgtttcctttcacagtccagtgacgcaggatgacaccaagcgccacagcctc
ggcaagcaccagaatgagggcccccagcccttcctggggacagtaaagaagtctccagaa
tccccggtcaagctgggtgcacccccatcggcctgcccacggcacatgaggatcaaaaac
tggggcagtggggtgactttccaagatacacttcaccacaaggccaaaggggatcttgct
tgcaagtccaagtgttgcctgggagccatcatgaaccccaaaagtttgaccagaggacct
agggacaagcctacctccccagaagagcttctacctcaagctatcgagtttgtcaaccag
tattatagctccttcaaagagtcaaaaatagaggaacatctggctagggtggaagcagtg
acaaaggagatagaaacaacaggaacctaccggctgacaggagatgagctcatctttgcc
accaagcaggcctggcgcaatgctccccgctgcatcgggaggatccagtggtccaaccta
caggtcttcgacgcccggagctgttccactgcccaggaaatgttcgagcatatctgcaga
cacctgcgctatgccaccaacaacggcaacatcaggtcggccatcaccgtgttccctcag
cggagtgatgggaaacacgacttccggatctggaactcgcagctcatccggtatgctggt
taccagatgcctgatggtaccgtcagaggggaccgtgcctgcgtggagttcacccagctg
tgcattgacctgggctggaagccgaagtacggccgcttcgatgtgttgcctctggtcctg
caggctgatggccatgaccctgaattctttgaaatcccgtctgaccttgtactcgaggtg
cccatggaacatcccaagtacgaatggttccaggaactggagctcaagtggtatgccctg
cctgcagtgtccaatatgttgcttgaggtgggtggccttgagttcccagggtgccccttc
aacggctggtacatgggcacagagatcggggtccgggacttctgtgacgtccagcgctac
aacatcctggaggaagtgggcagaaggatgggcctagaaacacacaagttgacctctctc
tggaaagaccaggctgtcattgagatcaatgtcgctgtgctccacagtttccagaagcaa
aacgtgaccatcatggatcaccactctgctgcagagtcattcatgaagtacatgcagaat
gagtaccggtcccgagggggctgcccagctgactgggtttggctggtccccccaatttct
ggaagcatcacccccgtgttccaccaggagatgttaaactatgttctgtcccctttctac
tactaccaggtggagccctggaaaacccacgtctggcaggatgagaagcggagaccccag
agaagagagattcgattccaagtcttggttaaagccgtgctcttcacctccatgctgatg
cacaagactatggcatcccgggtcagagccacagtcctttttgcaacggagacaggaaaa
tcagaaaccttggcccgggacctaggcgccttgttcagccgtgccttcaaccccaaggtt
ctctgcatggatgagtacaggctgagcagcctggaggaggagcagctgcttctggtggtg
accagtacatttgggaatggagactcccccggcaacggagagaaactgaagaaatccctc
ctcatgctgaaagagctcaccaacaagttcaggtatgccgtgtttggcctcggttccagc
atgtatcctcagttctgcgcctttgctcatgacatcgaccagaagttgtctcacctggga
gcctctcagctcaccccaacaggggaaggggatgaactcagtgggcaggaggaagccttc
cgcagctgggccgtgcaaaccttcaaggcagcctgtgagacgttcaacatccgaggcaaa
cagcacattcagatccccaagctctacactaccaatgtaacctgggacccgcaccactac
aggcttgtgcaggacccacagcctttggacctcaacaaagcactcagcagtatgcacgcc
aagaatgtgttcaccttgaagctcaaatcgcagcagaatctacagagtctgaagtccagc
cgcaccaccctcctggtggaactctcctgtgagggcagccaaggtctcagctacctgccc
ggagagcacctgggggttttcccaagcaaccagctggccctggtccaaggcattttggag
cgagtggtggacagccctgcaccccaccaatccatgcgcctggagaacctcagtgagacc
ggcagctactgggtcagggacaagcggctgcccccctgctcactcagccaagccctcacc
tacttcctggatatcaccaccccaccaacccaactgctgctccgaaagctggcccagttg
gccctggaagagaccgataggcagaagctagaaacactgtgccagccctcggaatataat
aagtggaagttcaccaacagccccacgttcttggaggtgctagaggagttcccatccctg
cgggtgtctgccaccttcctgctctcccagctccctattctgaaaccgcggtactactcc
atcagctcctccagggaccacacacccacggaggtccacctcacggtggccgtgctcacc
taccgcacccgagatggccagggtcccctacaccacggtgtctgcagcacatggcttagc
agcctgaagccccaagacccagtgccttgctttgtaagaagtgccagtggcttccagctt
cctgaggacccctcccatccctgcatcctcatcgggcctggcacgggcatcgctcccttc
cgcagtttttggcagcagcggctccatgatgctgagcacaaagggctccagggcggccgc
atgatcctgttgtttgggtgccggcgcccagatgaggaccacctctatcaggaggagatg
ctggagatggcccggaagggggtgctgcatggggtgcacacagcctactctcgcctgcct
ggccagcccaaggtctatgttcaagacatcctgcggcagcggctggctggtgaggtgctt
cgcgtgctccatgaggagcaaggccacctctatgtctgcggggacgtgcgcatggcccgg
gatgtggcccacaccctgaagaagctggtggctgccaaactgagcctgagtgaggagcag
gtcgaggactatttcttccagcttaagagccagaagcgctatcatgaagatatctttggt
gctgcatttccctatgaggcaaaaaaggatggggcagccgggcagcccagtaatatcaga
gcgccaacagaccagaggagaatttaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513162
Entry
107513162         CDS       T06036                                 

Gene name
NOS1
Definition
(RefSeq) LOW QUALITY PROTEIN: nitric oxide synthase, brain
  KO
K13240  nitric-oxide synthase, brain [EC:1.14.13.39]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00220  Arginine biosynthesis
ray00330  Arginine and proline metabolism
ray01100  Metabolic pathways
ray04020  Calcium signaling pathway
ray04145  Phagosome
ray04371  Apelin signaling pathway
ray04713  Circadian entrainment
ray04730  Long-term depression
ray04926  Relaxin signaling pathway
ray04970  Salivary secretion
ray05010  Alzheimer disease
ray05014  Amyotrophic lateral sclerosis
ray05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    107513162 (NOS1)
   00330 Arginine and proline metabolism
    107513162 (NOS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107513162 (NOS1)
   04020 Calcium signaling pathway
    107513162 (NOS1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107513162 (NOS1)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    107513162 (NOS1)
  09154 Digestive system
   04970 Salivary secretion
    107513162 (NOS1)
  09156 Nervous system
   04730 Long-term depression
    107513162 (NOS1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107513162 (NOS1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107513162 (NOS1)
   05014 Amyotrophic lateral sclerosis
    107513162 (NOS1)
   05022 Pathways of neurodegeneration - multiple diseases
    107513162 (NOS1)
Enzymes [BR:ray01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     107513162 (NOS1)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 PDZ PDZ_6 PDZ_2 Flavodoxin_5
Other DBs
NCBI-GeneID: 107513162
NCBI-ProteinID: XP_016004995
LinkDB
Position
Unknown
AA seq 1434 aa
MENHTFSVQQIQPNVISVRLFKRKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSGLIQA
GDIILAVNGQPLVDLAYDSALEVLRGIASETHVVLILRGPEGFTTHLETTFTGDGTPKTI
RVTQPLGPSSTAVDLSHQSSACKEQPVAVDRAPGPGNGLQHAHDNGQEAGSLSHTNGLAP
RPPSQFPAKRSAGVALQSGGEHNELLKEIEPVLNLLTGGGRGINGGAPAKVETKDAEVQV
DRDLDGKSHKPLPLGAENDRVFNDLWGKGNVPVVLNNPYSEKEQPPASGKQSPTKNGSPS
KCPRFLKVKNWETDVVLTDTLHLKSTLETGCSEHICMGSVIHAPQQVRRPEDVRTKEQLF
PLAKEFIDQYYSSIKRFGSKAHMERLEEVNKEIEVTSTYQLKDTELIYGAKHAWRNASRC
VGRIQWSKLQVFDARDCTTAHGMFNYICNHIKYATNKGNLRSAITIFPQRIDSKHDFRVW
NSQLIRYAGYKQPDGSILGDPASVELTEICVQQGWKPPRGRFDVLPLLLQANGNDPELFQ
IPPELVLEVPIRHPKLEWFEDLGLKWYGLPAVANMLLEIGGLEFSACPFSGWYMGTEIGV
RDYCDNSRYNILEEVAKKMNLDMRKTSSLWKDQALVEINIAVLYSFQSDKVTIVDHHSAT
ESFIKHMENEYRCRGGCPADWVWIVPPMSGSITPVFHQEMLNYRLTPSFEYQPDPWNTHV
WKGTNGTPTKRRAIGFKKLAEAVKFSAKLMGQAMARRVKATILYATETGKSQAYAKTLCE
IFKHAFDAKVMSMEEYDIVHLEHETLVLVVTSTFGNGDPPENGEKFGCALMEMRHPNSVH
EERKSYKVRFNSVSSYSDARKSSGDGPDLRDNFESAGPLANVRFSVFGLGSRAYPHFCAF
GHAVDTLLEELGGERILKMREGDELCGQEEAFRTWAKKVFKAACDVFCVGDDVNIEKANN
SLISNDRSWKRNKFRLTYVAEAPELAQGLSNVHKKRVSAARLLSRQNLQSPKSSRSTIFV
RLHTNGNQELQYQPGDHLGVFPGNHEDLVNALIERLEDAPPVNQLVKVELLEERTTALGV
ISNWTDELRLPPCTIFQAFKYYLDITTPPTPLQLQQFASLATSEQEKQRLLVLSKGLQEY
EEWKWGKNPTVVEVLEEFRSIQMPTTLLLTQLSLLQPRYYSISSSPDMYPEEVHLTVAIV
SYRTRDGEGPIHHGVCSSWLNRIQADEVVPCFVRGAPSFHLPRNPQVPCILVGPGTGIAP
FRSFWQQRQFDIQHKGMSPCPMVLVFGCRQSKVDHIYREETLQARDTGVFRELYAAYSRE
PDKPKKYVQDILQEQLAETVYRALKEQGGHIYVCGDVTMAADVLKAIQRIMTRQGKLSVE
DAGVFISRLRDDNRYHEDIFGVTLRTYEVTNRLRSESIAFIEESKKDADEVFSS
NT seq 4305 nt   +upstreamnt  +downstreamnt
atggagaatcacacgttcagcgttcagcaaatccagcccaacgtgatttccgtccgactt
ttcaagcgcaaagtggggggcctggggttccttgtgaaggagcgggtgagcaagcccccc
gtgatcatttccgacctgattcgcgggggtgccgcggagcagagcggcctcatccaggcg
ggagacatcatcctcgcggtcaacgggcagcctttggtggacctggcttacgacagcgcc
ctggaggtgctgaggggcatcgcctccgagacccacgtggtcctcattctgaggggcccc
gagggcttcaccacgcacctggagaccaccttcacgggggacgggacccccaagaccatc
cgggtgacacagcccctgggtccctcctccacagccgtggacctgtcacaccagtcgtcg
gcctgcaaagagcagccagtggcagtggacagggccccaggtccaggtaacgggctgcag
catgcacacgacaacgggcaggaagcgggctcgctgtcccacaccaatggtctagctccc
aggcccccgagccagttccctgccaagagaagtgccggggtcgccctccagagcggtggg
gaacacaatgaactgctcaaagagatagagcctgtgctgaaccttctcaccggcggtggc
agagggatcaatggaggtgcacctgccaaggtggagacgaaagacgcagaggtccaggtg
gacagagatctggacggcaagtcacacaaaccgctgccccttggtgcggagaatgaccga
gtcttcaatgacctgtgggggaagggcaatgtgcccgtggtcctcaacaacccgtattca
gagaaggagcagccccccgcctcgggaaaacagtcccccacaaagaacggtagcccctcc
aagtgcccccgcttcctcaaggtcaagaactgggagactgacgtggttctcactgacacg
ctccaccttaagagcacattggaaacgggatgcagtgagcacatctgtatgggctccgtc
atacacgcacctcagcaggtgcgaaggcccgaagacgtccgcacgaaagaacagctcttc
cctctcgccaaagagtttattgatcagtactactcgtcgatcaaaagatttggctccaaa
gcccacatggagaggctggaagaggtgaacaaggagattgaagtcaccagcacctaccag
ctcaaggacacggagctcatctacggggccaagcacgcctggaggaacgcctcccgctgc
gtcggcaggatccagtggtccaagctgcaggtgtttgatgcccgcgactgcaccacggct
cacgggatgttcaactacatttgcaaccacatcaagtatgccaccaacaaagggaacctc
aggtctgcgatcaccatattcccgcagaggatcgacagcaagcatgatttccgagtctgg
aactcccagctcatccgctatgccggctacaagcagcccgacggctccatcctgggggat
ccagccagtgtggagctcacagagatctgcgtgcagcagggttggaaacccccaagaggc
cgcttcgatgtcctgccgctcctgctccaggccaatggcaacgaccccgagctctttcag
attcctccggagctggtgttggaagtgcccatcagacaccccaagttggagtggttcgag
gacctggggctgaagtggtatggcctccccgcagtggccaacatgcttctggagatcggt
ggcctggagttcagcgcctgtcccttcagcggctggtacatgggcacggagattggcgtc
cgcgactactgcgataactctcgctacaacatcctcgaggaagtggccaagaagatgaac
ttggacatgaggaagacgtcctccctgtggaaggaccaggcgctggtggagatcaacatc
gcagttctctacagcttccagagtgacaaagtgaccatcgtcgaccaccactctgccacc
gagtccttcattaagcacatggagaatgaataccgatgccgggggggctgcccggccgac
tgggtgtggatcgtgccccccatgtccggcagcatcacccccgtcttccaccaggagatg
ctcaactaccggctcaccccctccttcgagtaccagcctgacccttggaacacccatgtc
tggaaaggcaccaatgggacccccacaaagaggcgagccatcggcttcaagaagctggca
gaggctgtcaagttctcggccaagctgatggggcaggcaatggctagaagggtcaaggcg
accatcctttatgccacagagacaggcaaatcgcaggcctacgccaaaaccttgtgtgag
atcttcaaacacgcctttgacgccaaggtgatgtccatggaagaatatgacatcgtgcat
ctggaacacgaaactctggtcctggtcgtcaccagcaccttcggcaacggagacccgccc
gagaacggggagaaattcggctgtgctttgatggaaatgaggcaccccaactctgtgcat
gaggaaaggaagagctacaaggtcaggttcaatagcgtttcctcatattctgacgcccgc
aaatcatccggtgacgggcctgacctcagagacaactttgagagcgctggacccctggca
aatgtgaggttctcagtgttcgggctcggctcacgggcgtaccctcacttctgcgccttt
ggacatgccgtagacaccctcctagaagagctgggaggagagaggatcctgaagatgagg
gagggggacgagctctgtgggcaggaagaggctttcaggacctgggccaagaaggtcttc
aaggcagcctgcgatgtgttctgcgtgggggatgacgtcaacatcgagaaggcgaacaac
tctctcatcagcaatgatcgcagctggaagaggaacaagttccgcctcacctacgtggcc
gaagccccagaacttgcacaaggtctatccaacgtccacaaaaagcgggtctcggctgct
cgtctcctgagccgtcaaaaccttcagagtcctaaatccagccgatccaccatcttcgtg
cgtctgcacaccaatgggaatcaggagctgcagtaccagcccggcgaccacctgggtgtc
ttccctggcaatcacgaggacctcgtgaacgccttgatcgagcggctggaggatgcaccc
cccgtcaaccagctggtgaaggttgagctgctggaggagcggaccacagctttgggcgtt
atcagtaactggaccgacgagctccgcctcccgccctgcaccatcttccaggccttcaag
tactacttggacatcaccacgccccccacgccactgcagctgcagcagtttgcctcccta
gccaccagtgagcaagagaagcagcgtctgctggtcctcagcaagggcttgcaggagtat
gaggagtggaaatggggcaagaaccccaccgtcgtggaggtgctggaggagttccggtcc
atccagatgcccaccacgctgctcctgacccagctgtccctgctgcagcctcgctactac
tccatcagctcctccccggacatgtaccccgaggaggtgcacctgaccgtggccatcgtc
tcctaccgcacccgagatggagaaggaccaattcaccacggcgtgtgctcctcctggctc
aaccggatacaggctgacgaagtggtcccctgcttcgtgagaggagcacccagcttccac
ctgccccgaaacccccaagtgccctgcatcctggtcggccccggcactgggatcgcccct
tttcgaagcttctggcagcaacggcagtttgatatccaacacaaaggaatgagcccttgc
cccatggtcctggtcttcgggtgccggcaatccaaggtagatcatatctacagggaggag
accctacaggccagggacacaggcgtcttcagagaactatacgcggcctactcccgcgag
ccagacaaaccaaagaagtacgtacaggatatcctgcaagagcagctggcggaaactgtg
taccgagccctgaaggagcaagggggccacatttacgtctgtggggatgtcaccatggcc
gccgacgtcctcaaagccatccagcgcatcatgacccggcaggggaagctctcggtggag
gacgccggcgtgttcatcagccgcctgagggatgacaaccgctaccatgaggatattttc
ggggtcactctgcgaacatatgaagtgaccaaccgccttagatctgaatccattgccttc
atcgaagagagcaaaaaagacgccgatgaggtttttagctcctaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107520319
Entry
107520319         CDS       T06036                                 

Gene name
NOS3
Definition
(RefSeq) nitric oxide synthase, endothelial isoform X1
  KO
K13242  nitric-oxide synthase, endothelial [EC:1.14.13.39]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00220  Arginine biosynthesis
ray00330  Arginine and proline metabolism
ray01100  Metabolic pathways
ray04020  Calcium signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04066  HIF-1 signaling pathway
ray04071  Sphingolipid signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04370  VEGF signaling pathway
ray04371  Apelin signaling pathway
ray04611  Platelet activation
ray04915  Estrogen signaling pathway
ray04921  Oxytocin signaling pathway
ray04926  Relaxin signaling pathway
ray04931  Insulin resistance
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    107520319 (NOS3)
   00330 Arginine and proline metabolism
    107520319 (NOS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    107520319 (NOS3)
   04371 Apelin signaling pathway
    107520319 (NOS3)
   04066 HIF-1 signaling pathway
    107520319 (NOS3)
   04020 Calcium signaling pathway
    107520319 (NOS3)
   04071 Sphingolipid signaling pathway
    107520319 (NOS3)
   04022 cGMP-PKG signaling pathway
    107520319 (NOS3)
   04151 PI3K-Akt signaling pathway
    107520319 (NOS3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107520319 (NOS3)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107520319 (NOS3)
   04921 Oxytocin signaling pathway
    107520319 (NOS3)
   04926 Relaxin signaling pathway
    107520319 (NOS3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107520319 (NOS3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    107520319 (NOS3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107520319 (NOS3)
Enzymes [BR:ray01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     107520319 (NOS3)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 HTH_15
Other DBs
NCBI-GeneID: 107520319
NCBI-ProteinID: XP_016019454
LinkDB
Position
Unknown
AA seq 1200 aa
MGNMKSVGQDPGPPCGLGLGLGLGLCSKQGPASPVSEPSWTPAPAPLPEPGHSPPPTRSP
EGPKFPRVKNWEVGSITYDTLSAQAQQDGPCTPRRCLGSLVFPRKLQGRPSQGPPPPEQL
LSQARDFINQYYSAIKRSGSQAHEQRLEEVEAQVAATGTYQLQESELVFGAKQAWRNAPR
CVGRIQWGKLQVFDARDCSSAQEMFTYICSHIKYSTNKGNIRSAITVFPQRAPGRGDFRI
WNSQLVRYAGYRQQDGSVRGDPANVEITELCIQHGWTPGNGRFDVLPLLLQAPDEPPELF
TLPPELVLEVPLEHPTLEWFAALGLRWYALPAVSNMLLEIGGLEFPAAPFSGWYTSTEIG
SRNLCDPHRYNILEDVAVCMDLDTRTSSSLWKDKAAVEINLAVLHSYQLAKVTIVDHHAA
TSSFMKHLENEQKARGGCPADWAWIVPPISGSLTPVFHQEMVNYFLSPAFRYQPDPWKGS
TARGAGITRKKTFKEVANAVKISASLMGTVMAKRVKATILYGSETGRAQSYAQQLGRLFR
KAFDPRVLCMDEYDVVFLEHETLVLVVTSTFGNGDPPENGESFAAALMEMSGPYNSSPRP
EQHRSYKIRFNSVSCSDPLVSSWRRKRKASSNTDSAGALGTLRFCVFGLGSRAYPHFCAF
ARAVDTRLEELGGERLLQLGQGDELCGQEEAFRGWAQAAFQASCETFCVGEDAKAAAQDI
FSPKRSWKRQRYRLTAQDECLQLLPGLMYVHRRKIFQATVLSVENLQSSKSTRATILVRL
DTGGKEGLQYQPGDHIGICPPNRPGLVEALLSRVEDLPPPGDTLAVEQLEKGSPGGPPPG
WVRDPRLPPCTLRQALTFFLDITSPPSPRLLQLLSTLAEEPGEQQELETLSQDPRRYEEW
KWFRCPTLLEVLEQFPSVALPAALLLTQLPLLQPRYYSVSSAPSAHPGEIHLTVAVLAYR
TQDGLGPLHYGVCSTWLSQLKAGNPVPCFIRGAPSFRLPPDPSLPCILVGPGTGIAPFRG
FWQERLHDIESKGLQPAPMTLVFGCRCSQLDHLYRDEVQDAQQRGVFGRVLTAFSREPGS
RKTYVQDILRTELAAEVHRVLCLERGHMFVCGDVTMATSVLQTVQRILATEGDMELDEAG
DVIGVLRDQQRYHEDIFGLTLRTQEVTSRIRTQSFSLQERHLRGAVPWSFDPPGSDTPGS
NT seq 3603 nt   +upstreamnt  +downstreamnt
atgggcaacatgaagagcgtgggccaggaccctgggccgccctgcggcctggggctgggg
ctgggcctcgggctgtgcagcaagcagggcccagcctccccggtgtctgagcccagctgg
acgccagcacctgcacccctgcctgagccaggccacagccccccgcccacccggtcccca
gaggggcccaagttcccgcgcgtgaagaactgggaggtggggagcatcacctacgacacc
ctgagtgcccaggcacagcaggacggaccctgcaccccaagacgctgcctgggctccctg
gtatttccacggaaactgcagggccggccgtcccagggccccccaccccccgagcagctg
ctgagccaggccagggacttcatcaaccagtactacagcgccatcaagcggagcggctcc
caggcccacgagcagcggcttgaggaggtggaagcccaggtggcggccacaggcacctac
cagcttcaggagagcgagctagtgttcggggccaagcaggcctggcgcaacgctccccgc
tgcgtgggccggatccagtgggggaagctgcaggtgtttgacgcccgtgattgcagctct
gcgcaggagatgttcacctacatctgcagccacatcaagtactccaccaacaagggcaac
atccgctcggcaatcacagtgttcccccaacgcgccccgggccgcggggacttccgcatc
tggaacagccagctggtgcgctacgcgggctaccggcagcaggacggctccgtgcgcggg
gacccggccaacgtggaaatcaccgagctctgcatccagcacggctggaccccgggaaac
ggccgcttcgacgtgctgcccctgctgctccaggccccggacgagcccccagaactcttc
actctgccccccgagctggtcctcgaggtgcccctggagcaccccacgctggagtggttc
gcggccctgggcctgcgctggtatgccctcccggccgtgtccaacatgctgctggagatc
gggggcctggagttccccgcggcgcccttcagcggctggtacacgagcaccgagatcggc
tcgcggaacctgtgcgacccgcaccgctacaacatcctggaggatgtggccgtctgcatg
gacctggacacccggacgtcctcgtccctgtggaaagacaaagcagctgtggaaatcaac
ttggccgtgctgcacagttaccagctggccaaagtgaccattgtggaccaccatgcggcc
acctcctccttcatgaagcacctggagaacgagcagaaggcgagggggggctgccctgcc
gactgggcctggatcgtgccccccatctcgggcagcctcacccctgtcttccatcaggag
atggtcaactatttcctgtcccctgcctttcgctaccagccggatccttggaaggggagc
acagccaggggtgccggcatcaccaggaaaaagacctttaaggaagtggccaatgcggtg
aagatctccgcctcactcatgggcaccgtgatggccaagcgtgtgaaggccacgatcctg
tatggctctgagaccggccgggcgcagagctacgcacagcagctggggaggctcttccgg
aaggctttcgacccccgggtcctgtgcatggatgagtatgacgtggtgttcctcgagcac
gagacgctggtgttggtagtgaccagcacatttgggaatggggatcccccagaaaacgga
gagagtttcgcagcggccctgatggagatgtccggcccctacaacagctcccctcggccc
gagcagcacaggagttacaaaatccgcttcaacagcgtctcctgctcagaccccctcgtg
tcctcctggcggcggaagagaaaggcgtccagtaacacggacagcgccggggccctgggg
accctcaggttctgcgtgttcgggctgggctcccgggcgtacccccacttctgcgccttt
gctcgtgcggtggacacgcggctggaagagctgggtggggagcggctcctgcagctgggc
cagggcgacgagctgtgcggccaggaggaggccttccgcggctgggcccaggctgccttc
caggcctcctgtgagaccttctgcgtgggcgaggacgccaaggccgccgcccaggacata
ttcagccccaaacggagctggaagcgccagaggtaccggctgacggcccaggatgagtgc
ctgcagctgctgccaggcctgatgtatgtgcacagacgaaagattttccaggccacggtc
ctctcagtggaaaacctgcagagcagcaagtccacccgggctaccatcctcgtgcgcctg
gacaccggaggcaaggaggggctccagtaccagccaggcgaccacataggcatctgcccg
cccaaccggcccggcctcgtggaggcgctgctgagccgcgtggaggacctgccgccacca
ggggacaccttggcagtggagcagctggagaagggcagccctggtggccctcccccgggc
tgggtgcgggacccccggctgcccccatgcaccctgcgccaggctctcaccttcttcctg
gacatcacttccccgcccagcccccgactccttcaactgctcagcaccctggctgaagag
cccggggaacagcaggagctggagaccctcagccaggacccccggcgctacgaggagtgg
aagtggttccgctgccccacgctgctggaggtgctggagcagtttccgtcagtggctctg
cccgccgcgttgctcctcacccagctgcccctgctccagccccggtactactcggtcagc
tcggcgcccagcgcccaccccggagagatccacctcacagtggccgtgctggcctacagg
acccaggatgggctgggccccctgcactacggcgtctgctccacgtggctgagccagctc
aaggccggaaacccggtaccctgcttcatcaggggggctccctccttccggctgccacca
gaccccagcttgccctgcatcctggtgggcccaggcactggcatcgcccccttccggggc
ttctggcaggagcggctacatgacattgagagcaaagggctgcagcccgcccctatgacc
ttggtgttcggctgccgatgctcccagctggaccacctctaccgcgacgaggtgcaggac
gcgcagcagcgcggagtgtttggccgcgtcctcaccgccttctcccgggaacccggcagc
cgtaagacctacgtacaggacatcttgcggacagagctggccgccgaggtgcaccgcgtg
ctgtgcctcgaacgaggccacatgtttgtctgcggcgatgtcaccatggcaaccagcgtc
ctgcagacagtgcagcgcatactggcgacagagggcgacatggagctggatgaggccgga
gacgtcatcggcgtgctgcgggatcagcaacgctatcacgaggacattttcgggctcacg
ctacgcacccaggaggtgacaagccgcattcgcacccagagcttttccttgcaggagcgg
catctgcggggcgcagtgccctggtcgttcgacccgcccggctcagacacccccggctcc
tga

DBGET integrated database retrieval system