KEGG   Rousettus aegyptiacus (Egyptian rousette): 107497427
Entry
107497427         CDS       T06036                                 

Gene name
ITPR2
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 2 isoform X1
  KO
K04959  inositol 1,4,5-triphosphate receptor type 2
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04020  Calcium signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04070  Phosphatidylinositol signaling system
ray04114  Oocyte meiosis
ray04210  Apoptosis
ray04218  Cellular senescence
ray04270  Vascular smooth muscle contraction
ray04371  Apelin signaling pathway
ray04540  Gap junction
ray04611  Platelet activation
ray04621  NOD-like receptor signaling pathway
ray04625  C-type lectin receptor signaling pathway
ray04720  Long-term potentiation
ray04723  Retrograde endocannabinoid signaling
ray04724  Glutamatergic synapse
ray04725  Cholinergic synapse
ray04726  Serotonergic synapse
ray04728  Dopaminergic synapse
ray04730  Long-term depression
ray04750  Inflammatory mediator regulation of TRP channels
ray04912  GnRH signaling pathway
ray04915  Estrogen signaling pathway
ray04918  Thyroid hormone synthesis
ray04921  Oxytocin signaling pathway
ray04922  Glucagon signaling pathway
ray04924  Renin secretion
ray04925  Aldosterone synthesis and secretion
ray04927  Cortisol synthesis and secretion
ray04928  Parathyroid hormone synthesis, secretion and action
ray04929  GnRH secretion
ray04934  Cushing syndrome
ray04935  Growth hormone synthesis, secretion and action
ray04970  Salivary secretion
ray04971  Gastric acid secretion
ray04972  Pancreatic secretion
ray05010  Alzheimer disease
ray05012  Parkinson disease
ray05017  Spinocerebellar ataxia
ray05020  Prion disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05163  Human cytomegalovirus infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05170  Human immunodeficiency virus 1 infection
ray05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107497427 (ITPR2)
   04020 Calcium signaling pathway
    107497427 (ITPR2)
   04070 Phosphatidylinositol signaling system
    107497427 (ITPR2)
   04022 cGMP-PKG signaling pathway
    107497427 (ITPR2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107497427 (ITPR2)
   04210 Apoptosis
    107497427 (ITPR2)
   04218 Cellular senescence
    107497427 (ITPR2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107497427 (ITPR2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107497427 (ITPR2)
   04621 NOD-like receptor signaling pathway
    107497427 (ITPR2)
   04625 C-type lectin receptor signaling pathway
    107497427 (ITPR2)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    107497427 (ITPR2)
   04929 GnRH secretion
    107497427 (ITPR2)
   04912 GnRH signaling pathway
    107497427 (ITPR2)
   04915 Estrogen signaling pathway
    107497427 (ITPR2)
   04921 Oxytocin signaling pathway
    107497427 (ITPR2)
   04935 Growth hormone synthesis, secretion and action
    107497427 (ITPR2)
   04918 Thyroid hormone synthesis
    107497427 (ITPR2)
   04928 Parathyroid hormone synthesis, secretion and action
    107497427 (ITPR2)
   04924 Renin secretion
    107497427 (ITPR2)
   04925 Aldosterone synthesis and secretion
    107497427 (ITPR2)
   04927 Cortisol synthesis and secretion
    107497427 (ITPR2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107497427 (ITPR2)
  09154 Digestive system
   04970 Salivary secretion
    107497427 (ITPR2)
   04971 Gastric acid secretion
    107497427 (ITPR2)
   04972 Pancreatic secretion
    107497427 (ITPR2)
  09156 Nervous system
   04724 Glutamatergic synapse
    107497427 (ITPR2)
   04725 Cholinergic synapse
    107497427 (ITPR2)
   04728 Dopaminergic synapse
    107497427 (ITPR2)
   04726 Serotonergic synapse
    107497427 (ITPR2)
   04720 Long-term potentiation
    107497427 (ITPR2)
   04730 Long-term depression
    107497427 (ITPR2)
   04723 Retrograde endocannabinoid signaling
    107497427 (ITPR2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107497427 (ITPR2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    107497427 (ITPR2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107497427 (ITPR2)
   05012 Parkinson disease
    107497427 (ITPR2)
   05017 Spinocerebellar ataxia
    107497427 (ITPR2)
   05020 Prion disease
    107497427 (ITPR2)
   05022 Pathways of neurodegeneration - multiple diseases
    107497427 (ITPR2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107497427 (ITPR2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107497427 (ITPR2)
   05163 Human cytomegalovirus infection
    107497427 (ITPR2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107497427 (ITPR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107497427 (ITPR2)
Ion channels [BR:ray04040]
 Ligand-gated channels
  IP3 receptor
   107497427 (ITPR2)
SSDB
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans DUF2207 DUF1798
Other DBs
NCBI-GeneID: 107497427
NCBI-ProteinID: XP_015974691
LinkDB
Position
Unknown
AA seq 2701 aa
MSDKMSSFLYIGDIVSLYAEGSVNGFISTLGLVDDRCVVHPEAGDLANPPKKFRDCLFKV
CPMNRYSAQKQYWKAKQAKQGNHTEAALLKKLQHAAELEQKQNESENKKLLGEIVKYSNV
IQLLHIKSNKYLTVNKRLPALLEKNAMRVSLDAAGNEGSWFYIHPFWKLRSEGDNIVVGD
KVVLMPVNAGQPLHASNIELLDNPGCKEVNAVNCNTSWKITLFMKYSSYREDVLKGGDVV
RLFHAEQEKFLTCDEYEKKQHIFLRTTLRQSATSATSSKALWEIEVVHHDPCRGGAGQWN
SLFRFKHLATGNYLAAELNPDYRDAQNEGKNVRDGDLPTSKKKRQAGEKIMYTLVSVPHG
NDIASLFELDATTLQRADCLVPRNSYVRLRHLCTNTWVTSTSIPIDTDEERPVMLKIGTC
QTKEDKEAFAIVSVPLSEVRDLDFANDANKVLATTVKKLENGTITQNERRFVTKLLEDLI
FFVADVLNNGQEVLDVVISKPNRERQKLMREQNILAQVFGILRAPFKEKAGEGPILRLED
LGDQRYAPYKYMLRLCYRVLRHSQQDYRKNQEYIAKNFYVMQSQIGYDILAEDTITALLH
NNRKLLEKHITAKEIETFVSLLRRNREPRFLDYLSDLCVSNTTAIPVTQELICKFMLSPG
NADILIQTKLVSMQVDNPMESSILTDDIDDEEVWLYWIDSNKEPHGKAIRHLAQEAKEGT
KADLEVLTYYRYQLNLFARMCLDRQYLAINQISTQLSVDLILRCVSDESLPFDLRASFCR
LMLHMHVDRDPQESVVPVRYARLWTEIPTKITIHEYDSITDSSRNDMKRKFALTMEFVEE
YLKEVVNQPFPFGDKEKNKLTFEVVHLARNLIYFGFYSFSELLRLTRTLLAILDIVQAPM
SSYFERLSKFQDGGNNVMRTIHGVGEMMTQMVLSRGSIFPVSVPDVQPSLHPSKQGSPTE
HEDVTVMDTKLKIIEILQFILSVRLDYRISYMLSIYKKEFGENNENAETSANGSPDTLLP
SAIVPDIDEIAAQAETMFAGRKEKNPVQLDDEGGRTFLRVLIHLIMHDYPPLLSGALQLL
FKHFSQRAEVLQAFKQVQLLVSNQDVDNYKQIKADLDQLRLTVEKSELWVEKSSSYENGE
MGENQVKGGEEPIEESNILSPVQDGTKKPQIDSNKSNNYRIVKEILIRLSKLCIQTKKCR
NQHQRLLKNMGAHSVVLDLLQIPYEKNDEKMNEVMNLAHTFLQNFCRGNPQNQVLLHKHL
NLFLTPGLLEAETMRHIFMNNYHLCNEISERVVQHFVHCIETHGRHVEYLRFLQTIVKAD
GKYVKKCQDMVMTELINGGEDVLIFYNDRASFPILLQMMCSERDRGDESGPLAYHITLVE
LLAACTEGKNVYTEIKCNSLLPLDDIVRVVTHDDCIPEVKIAYVNFVNHCYVDTEVEMKE
IYTSNHIWKLFENFLVDMARVCNTTTDRKHADTFLEKCVTESIMNIVSGFFNSPFSDNST
SLQTHQPVFIQLLQSAFRIYNCTWPNPSQKASVESCIRTLAEVAKNRGIAIPVDLDSQVN
TLFMKSHSNMVQRAAMGWRLSARSGPRFKEALGGPAWDYRNIIEKLQDVVASLEQQFSPM
MQAEFSVLVDVLYSPELLFPEGSDARIRCGAFMSKLINHTKKLMEKEEKLCIKILQTLRE
MLEKKDSFVEEGSTLRKILLNRYFKGDYGVGMNGHLSGTYCKSAQGGGSFSGQDSDKMGI
SMSDIQCLLDKEGASELVIDVIVNTKNDRIFSEGILLGIALLEGGNTQTQYSFYQQLHEQ
KKSEKFFKVLYDRMKAAQKEIRSTVTVNTIDLGNKKRDDDNELMTSGPRMRVRDSSLHLK
EGMKGQLTEASSATSKAYCVYRREMDPEIDIMCPGSEAGNAEEKSAEEVTMSPAIAIMQP
ILRFLQLLCENHNRELQNFLRNQNNKTNYNLVCETLQFLDCICGSTTGGLGLLGLYINEK
NVVLVNQTLESLTEYCQGPCHENQTCIATHESNGIDIIIALILNDINPLGKYRMDLVLQL
KNNASKLLLAIMESRHDSENAERILFNMRPRELVDVMKNAYNQGLECDHGDDEGGDDGVS
PKDVGHNIYILAHQLARHNKLLQQMLKPGSDPDDGDEALKYYANHTAQIEIVRHDRTMEQ
IVFPVPNICEYLTQESKCRVFNTTERDEQGSKVNDFFQQTEDLYNEMKWQKKIRNNPALF
WFSRHISLWGSISFNLAVFINLAVALFYPFGDDGDEGTLSPLFSVLLWIAVAICTSMLFF
FSKPVGIRPFLVSVMLRSIYTIGLGPTLILLGAANLCNKIVFLVSFVGNRGTFTRGYRAV
ILDMAFLYHVAYVLVCMLGLFVHEFFYSFLLFDLVYREETLLNVIKSVTRNGRSIILTAV
LALILVYLFSIIGFLFLKDDFTMEVDRLKNRTPITGSNDISTMTLSSMMRTCDTGNCSPT
IPASNTADEEYEDGIERTCDTLLMCIVTVLNQGLRNGGGVGDVLRRPSKDEPLFAARVVY
DLLFYFIVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFE
EHIKSEHNMWHYLYFLVLVKVKDPTEYTGPESYVAQMIVEKNLDWFPRMRAMSLVSNEGD
SEQNEIRNLQEKLECTMSLVKQLSGQLAELKEQMTEQRKNKQRLGFLGSNTPHVNHHMPP
H
NT seq 8106 nt   +upstreamnt  +downstreamnt
atgtctgataaaatgtccagcttcctctacataggggacatcgtgtccctgtacgcggag
ggctcggtcaacggcttcatcagcaccctggggttagtagatgatcggtgtgtggtgcac
ccagaagcaggagaccttgccaaccctcccaagaagttcagagactgcctctttaaggta
tgtcctatgaatcgatattctgcccagaagcaatattggaaagctaagcaagccaaacaa
ggaaaccacacagaggcagccttgctgaagaaattacagcatgctgcagaactggagcaa
aaacaaaatgaatcagaaaataagaaactgttaggagaaatcgtgaaatacagtaatgtt
atacaactactgcatatcaaaagtaacaagtatctgactgtcaacaagagattacctgct
ttattggagaagaatgccatgcgtgtgtccttggatgctgcaggaaatgaaggatcttgg
ttttatattcatcccttctggaagctgagaagcgagggtgacaatattgttgtaggagat
aaagttgttttgatgcccgtgaatgcaggacagccactacatgccagcaacattgagctt
cttgataatccaggttgtaaagaggtgaatgctgttaattgcaacacgagctggaaaatc
actttattcatgaaatatagctcctatcgagaggatgtcctgaaaggaggtgatgttgtt
agattgtttcatgcggaacaagagaagtttctgacttgtgatgaatatgagaaaaaacag
cacattttccttcgtacaaccttgcgtcaatcagccacttctgctactagttctaaagca
ctctgggaaatagaggtggttcatcatgacccatgccgtgggggtgcaggacaatggaac
agcttgttcagatttaaacatcttgctactgggaactatttagctgcagagcttaatcct
gattatcgagatgcccaaaacgaaggaaaaaatgtgagagatggagatcttccaacttca
aagaagaaacgccaggcaggggagaagatcatgtataccttggtctcagtcccacatgga
aatgatattgcgtctctttttgaattggatgccacaactcttcagagagctgactgcctg
gttccaaggaactcgtatgttcggttaagacatttatgtaccaacacgtgggtaaccagt
acgagtatccccatagacacagatgaagagaggcctgttatgttgaagattggaacttgc
cagaccaaagaagacaaagaagcatttgccattgtgtctgtcccgctgtccgaggtccga
gacttagattttgccaatgatgcaaataaagtgctggcgaccacagttaaaaagctggaa
aatggcacaataactcagaatgaaaggaggtttgtaaccaaattattggaggacctcatc
ttctttgttgctgatgtacttaataatggacaagaagttctggatgtggttatctctaag
ccaaaccgagaacgtcagaaattaatgagggaacaaaacatattggcacaggtatttggg
attcttagagcaccctttaaggagaaagcaggagaaggcccgattctgaggcttgaagat
ctgggggaccaaagatatgctccctacaaatacatgctgaggctctgctaccgcgtgctg
agacattcacagcaggactaccggaaaaatcaggaatatattgctaagaatttctatgtc
atgcagtcccagattggctatgatattttggcagaagataccatcacagctttgttgcac
aacaacagaaaactactagagaaacatatcacagcaaaagaaatagaaacatttgtcagt
ttacttaggagaaaccgtgagccaagattcttagattatttgtcagatctgtgtgtgtct
aataccactgctatacctgtaactcaagaactcatctgtaaattcatgttgagcccaggc
aatgcagatattctcattcaaactaagctggtttcgatgcaagtggacaaccccatggag
agctccatccttacagatgacatcgatgatgaggaagtttggctctactggattgacagc
aacaaagaacctcatggcaaagctattagacatcttgctcaagaagcaaaggaaggcacc
aaagctgacttagaagttcttacctactacaggtatcagctaaacctctttgcaaggatg
tgcttggatcgccaatatctggccatcaaccagatttctacgcagctttctgttgatttg
attctgcggtgtgtgtcggatgagagcttgccatttgacctccgagcatctttttgtcgc
ctcatgctccacatgcatgttgaccgggatccccaagagtccgtggtgcctgttcgttat
gccaggctctggacagaaatccccacaaagatcacgattcatgaatatgattctataaca
gactcttccagaaatgatatgaagaggaaatttgcactgacaatggaatttgttgaagaa
tacttgaaagaagttgtaaatcagccttttccttttggtgataaagaaaaaaacaaactg
acatttgaggtggtccacttggctcggaatctcatatactttggattttatagtttcagt
gagttactaagactaacaagaacacttctggctatcctagatattgtacaggcccccatg
tcatcatattttgaaagattaagcaaatttcaagatggaggaaacaatgtcatgagaacc
attcatggggtgggagagatgatgacccagatggtgctcagtagaggctctatcttccct
gtaagtgtgcctgatgttcagcccagcctccaccccagcaagcaggggagccccaccgag
catgaggacgtgaccgtgatggacaccaaactgaagattattgagattttacagtttatc
cttagtgtcagactagattatcggatctcatatatgctgtccatatataagaaggaattc
ggagagaacaacgagaatgctgaaacgtctgcaaacggctctccggacacgttgctccca
tcagctattgttcctgatatagatgaaattgcagctcaggcagaaactatgtttgctgga
agaaaagagaaaaatccagttcagctcgatgatgaaggaggcaggacgtttttacgggtc
cttattcatctgatcatgcatgactatcctcctttgctgtcaggagccctgcagcttctg
ttcaagcacttcagccagagagcagaagttttacaggcatttaaacaggtgcaattgctg
gtgtccaatcaagatgtagataactacaagcaaataaaggcagatctagaccagcttcga
ctaactgtagaaaaatctgagttatgggttgagaagagtagcagctatgagaatggagaa
atgggtgaaaatcaagtaaaaggtggtgaagagccaattgaggaatcaaacattttaagt
ccagtgcaggatggaacaaagaaaccgcagattgacagcaataagagcaataactaccgg
attgtaaaggagattttgattaggctaagtaaactgtgtatacagactaaaaagtgtcgg
aatcaacatcaacgattactgaaaaatatgggagctcattcagtggtgttggatcttctg
cagattccttatgaaaagaatgatgaaaagatgaatgaagtaatgaacctggcccataca
ttcctgcagaatttctgtcggggaaacccacagaatcaggttctccttcataaacatctg
aatttgtttttaactcctgggctccttgaagcagaaaccatgcggcacatcttcatgaac
aattaccatctgtgcaatgaaatcagcgagagagttgtgcagcattttgtgcactgcatt
gagacacacggccgccacgtggagtacctgaggtttttgcaaacgattgtaaaagcagat
ggtaaatatgtgaagaaatgccaggatatggtaatgacagagttgataaacgggggtgaa
gatgtgctgatattttacaatgatagagcatcgttccctatccttctccaaatgatgtgt
tcagagagagaccggggggacgagagtggtcctctagcctaccacatcaccctcgtggag
ttgctggccgcgtgtacagaggggaagaacgtctacactgaaatcaagtgcaattccctt
ctgcccctggacgacatagtgagggtggtgacgcacgatgactgcatccctgaggttaaa
attgcatatgtgaattttgttaatcactgttatgttgacactgaagtggaaatgaaagaa
atttatacaagtaaccacatttggaaattatttgagaacttcttggtggatatggcaagg
gtttgcaacacaaccacagacaggaagcatgcagacaccttcctggagaagtgtgttact
gagtcaataatgaacattgtgagcggcttctttaattctcctttttcggacaacagtacc
agtctccagacacatcagccagtttttattcagctactgcaatctgccttcagaatttac
aattgtacctggccaaacccgtcgcagaaagcttcagtggagtcctgtatcagaaccttg
gccgaagtggcaaagaatcgtggaattgctattcccgtggatttggacagccaagttaat
actcttttcatgaagagccattcaaatatggtgcagagagcagccatgggttggagacta
tccgctcgctctggaccacgctttaaggaagctctcggagggcctgcttgggattataga
aatattattgaaaagttacaggacgtggtggcctccctggagcagcagttcagcccgatg
atgcaggctgagttctcagtgttggtcgatgtgttgtacagcccagagctactgttccct
gaggggagcgacgcaagaatacgatgcggcgctttcatgtccaagttgattaatcataca
aagaaactaatggagaaagaagaaaaactatgcattaaaattcttcagactttacgagaa
atgctagagaagaaagacagctttgtggaagagggtagcacattaagaaaaatactcctg
aatcgatactttaaaggtgattatggagttggtatgaatggacacctttctggaacctac
tgcaagtctgcacaagggggaggaagcttttctggacaagattcagataagatggggata
tcaatgtcagatattcaatgtctgctggataaagaaggtgcatctgaacttgtcatcgat
gttatagtgaacaccaaaaatgacagaattttttcagaaggcattttacttggcattgca
ttgctcgaaggaggaaatacacaaactcagtattccttctaccagcaattacatgaacaa
aaaaagtcagaaaaattcttcaaagttctatatgaccgaatgaaggctgctcagaaagag
ataagatcaacagtgacagttaataccatcgacttaggtaataaaaaaagggatgatgac
aatgaattgatgacatctggtccccgaatgagagtaagagattcatcattacatttaaaa
gaggggatgaaagggcaattaacagaagcttcttcagcaacatccaaagcatactgtgta
tacagaagagaaatggatccagaaatagacattatgtgcccaggatcagaagcaggaaac
gctgaggaaaaatctgcagaggaagtaacaatgagtcctgcaattgccatcatgcagcca
atactaaggtttcttcagttactatgcgaaaatcacaatcgagaattgcagaacttcttg
aggaatcaaaacaacaaaacaaattacaaccttgtctgtgaaacccttcagtttttggac
tgcatttgtggaagtacaacgggaggcctgggccttttgggtctctatatcaatgagaag
aatgtagtgctggtcaaccagactctggaaagcttgacagagtattgccaggggccgtgc
catgaaaatcagacatgtattgctactcatgaatccaatgggattgatatcatcattgct
ttgattctaaatgacataaaccctcttggtaaatatcgaatggacctggtgctccaacta
aagaacaatgcttccaagcttttgctggccattatggaaagcagacatgacagtgagaat
gcagaaagaattctttttaacatgagacccagggaactggtggatgtgatgaaaaatgcc
tataaccaaggactggaatgtgatcatggagatgatgagggaggagatgatggcgtttcc
ccaaaagatgttggacacaatatctacattctggcccatcagttggcccgccacaacaaa
ttattacagcagatgcttaaaccaggatcagatccagatgacggagatgaagccttaaag
tattatgccaaccacactgcacagattgaaattgttcggcacgataggactatggagcaa
atagtttttcctgttcccaatatatgtgaataccttacacaagaatctaagtgccgtgtg
ttcaatacaactgaaagggatgaacagggaagtaaagtgaatgactttttccagcaaact
gaggacctctacaatgaaatgaagtggcagaagaaaatcaggaataaccctgccctgttc
tggttctcgaggcacatatctctctggggaagcatttccttcaacttggctgtgtttatc
aacttagctgttgctctcttctacccatttggggatgatggagatgaaggtacactttct
ccattgttctcagttcttctttggatagcagttgcaatctgcacatctatgctgtttttc
ttctctaagcctgtgggaattcggccatttcttgtgtcagtaatgctaagatctatatat
acaataggtcttgggcctacgttaatacttcttggcgcagcaaatctttgtaataaaata
gtgtttctggtgagttttgtcggaaatcgtggcacgtttacccgaggataccgagcagtc
atcctggatatggcctttctctaccatgtagcatatgtcctggtttgcatgctgggcctc
tttgtccatgaattcttctatagctttctgctttttgatttggtgtacagagaagagact
ctgcttaatgttataaagagtgtcacacggaatggccgctccattattctaactgcagtc
ctcgctctcatccttgtctacctgttttccattattgggttcctttttctgaaggatgac
ttcactatggaagtggataggctaaaaaacagaactcccattacaggaagtaatgacatt
tctaccatgactttaagttcaatgatgagaacatgtgacacgggaaactgctcacctacg
ataccagcttcaaatacagctgatgaagagtacgaggatggaattgaaaggacatgtgac
actcttcttatgtgcatcgtcaccgttctgaaccagggcctcaggaatggaggcggcgtg
ggagacgtgctgagaaggccatccaaagatgaacccctatttgctgcccgagtggtgtat
gatcttcttttttatttcattgttattattatcgttcttaacttgatttttggtgtcatc
attgatacttttgctgatctcagaagcgaaaaacagaaaaaagaagaaattctgaagaca
acctgcttcatctgtggactcgagagggacaagtttgataataaaacagtttcatttgag
gagcacatcaagtcagaacacaatatgtggcattatttgtacttcctagtcttggtgaag
gttaaagaccccactgaatacactggacctgaaagttatgtggctcaaatgattgtggag
aagaatttggactggtttcctcggatgcgagccatgtcgcttgttagcaatgaaggtgac
agtgagcaaaatgaaattcggaacctgcaagagaagttggaatgtaccatgagtctggtc
aaacagctgtcaggtcagctggcggagctcaaggaacagatgacagaacaaaggaagaat
aagcagagactgggctttctcggatcaaacacaccccatgtgaatcatcacatgccaccg
cactga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107504134
Entry
107504134         CDS       T06036                                 

Gene name
ITPR1
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 1 isoform X1
  KO
K04958  inositol 1,4,5-triphosphate receptor type 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04020  Calcium signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04070  Phosphatidylinositol signaling system
ray04114  Oocyte meiosis
ray04140  Autophagy - animal
ray04210  Apoptosis
ray04218  Cellular senescence
ray04270  Vascular smooth muscle contraction
ray04371  Apelin signaling pathway
ray04540  Gap junction
ray04611  Platelet activation
ray04621  NOD-like receptor signaling pathway
ray04625  C-type lectin receptor signaling pathway
ray04713  Circadian entrainment
ray04720  Long-term potentiation
ray04723  Retrograde endocannabinoid signaling
ray04724  Glutamatergic synapse
ray04725  Cholinergic synapse
ray04726  Serotonergic synapse
ray04728  Dopaminergic synapse
ray04730  Long-term depression
ray04750  Inflammatory mediator regulation of TRP channels
ray04912  GnRH signaling pathway
ray04915  Estrogen signaling pathway
ray04918  Thyroid hormone synthesis
ray04921  Oxytocin signaling pathway
ray04922  Glucagon signaling pathway
ray04924  Renin secretion
ray04925  Aldosterone synthesis and secretion
ray04927  Cortisol synthesis and secretion
ray04928  Parathyroid hormone synthesis, secretion and action
ray04929  GnRH secretion
ray04934  Cushing syndrome
ray04935  Growth hormone synthesis, secretion and action
ray04970  Salivary secretion
ray04971  Gastric acid secretion
ray04972  Pancreatic secretion
ray05010  Alzheimer disease
ray05012  Parkinson disease
ray05016  Huntington disease
ray05017  Spinocerebellar ataxia
ray05020  Prion disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05163  Human cytomegalovirus infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05170  Human immunodeficiency virus 1 infection
ray05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107504134 (ITPR1)
   04020 Calcium signaling pathway
    107504134 (ITPR1)
   04070 Phosphatidylinositol signaling system
    107504134 (ITPR1)
   04022 cGMP-PKG signaling pathway
    107504134 (ITPR1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107504134 (ITPR1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    107504134 (ITPR1)
   04210 Apoptosis
    107504134 (ITPR1)
   04218 Cellular senescence
    107504134 (ITPR1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107504134 (ITPR1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107504134 (ITPR1)
   04621 NOD-like receptor signaling pathway
    107504134 (ITPR1)
   04625 C-type lectin receptor signaling pathway
    107504134 (ITPR1)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    107504134 (ITPR1)
   04929 GnRH secretion
    107504134 (ITPR1)
   04912 GnRH signaling pathway
    107504134 (ITPR1)
   04915 Estrogen signaling pathway
    107504134 (ITPR1)
   04921 Oxytocin signaling pathway
    107504134 (ITPR1)
   04935 Growth hormone synthesis, secretion and action
    107504134 (ITPR1)
   04918 Thyroid hormone synthesis
    107504134 (ITPR1)
   04928 Parathyroid hormone synthesis, secretion and action
    107504134 (ITPR1)
   04924 Renin secretion
    107504134 (ITPR1)
   04925 Aldosterone synthesis and secretion
    107504134 (ITPR1)
   04927 Cortisol synthesis and secretion
    107504134 (ITPR1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107504134 (ITPR1)
  09154 Digestive system
   04970 Salivary secretion
    107504134 (ITPR1)
   04971 Gastric acid secretion
    107504134 (ITPR1)
   04972 Pancreatic secretion
    107504134 (ITPR1)
  09156 Nervous system
   04724 Glutamatergic synapse
    107504134 (ITPR1)
   04725 Cholinergic synapse
    107504134 (ITPR1)
   04728 Dopaminergic synapse
    107504134 (ITPR1)
   04726 Serotonergic synapse
    107504134 (ITPR1)
   04720 Long-term potentiation
    107504134 (ITPR1)
   04730 Long-term depression
    107504134 (ITPR1)
   04723 Retrograde endocannabinoid signaling
    107504134 (ITPR1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107504134 (ITPR1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107504134 (ITPR1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    107504134 (ITPR1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107504134 (ITPR1)
   05012 Parkinson disease
    107504134 (ITPR1)
   05016 Huntington disease
    107504134 (ITPR1)
   05017 Spinocerebellar ataxia
    107504134 (ITPR1)
   05020 Prion disease
    107504134 (ITPR1)
   05022 Pathways of neurodegeneration - multiple diseases
    107504134 (ITPR1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107504134 (ITPR1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107504134 (ITPR1)
   05163 Human cytomegalovirus infection
    107504134 (ITPR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107504134 (ITPR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107504134 (ITPR1)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107504134 (ITPR1)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107504134 (ITPR1)
Ion channels [BR:ray04040]
 Ligand-gated channels
  IP3 receptor
   107504134 (ITPR1)
SSDB
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans
Other DBs
NCBI-GeneID: 107504134
NCBI-ProteinID: XP_015988617
LinkDB
Position
Unknown
AA seq 2749 aa
MSDKMSSFLHIGDICSLYAEGSTNGFISTLGLVDDRCVVQPEAGDLNNPPKKFRDCLFKL
CPMNRYSAQKQFWKAAKPGANSTTDAVLLNKLHHAADLEKKQNETENRKLLGTVIQYGNV
IQLLHLKSNKYLTVNKRLPALLEKNAMRVTLDEAGNEGSWFYIQPFYKLRSIGDSVVIGD
KVVLNPVNAGQPLHASSHQLVDNPGCNEVNSVNCNTSWKIVLFMKWSDNKDDILKGGDVV
RLFHAEQEKFLTCDEHRKKQHVFLRTTGRQSATSATSSKALWEVEVVQHDPCRGGAGYWN
SLFRFKHLATGHYLAAEVDPDFEEECLEFQPPADPDQDASRGRLRNAQEKMLYSLVSVPE
GSDISSIFELDPTTLRGGDSLVPRNSYVRLRHLCTNTWVHSTNIPIDKEEEKPVMLKIGT
SPVKEDKEAFAIVPVSPAEVRDLDFANDASKVLGSIAGKLEKGTITQNERRSVTKLLEDL
VYFVTGGTNSGQDVLEVVFSKPNRERQKLMREQNILKQIFKLLQAPFTDCGDGPMLRLEE
LGDQRHAPFRHICRLCYRVLRHSQQDYRKNQEYIAKQFGFMQKQIGYDVLAEDTITALLH
NNRKLLEKHITAAEIDTFVSLVRKNREPRFLDYLSDLCVSTNKSIPVTQELICKAVLNPT
NADILIETKLVLSRFEFEGVSTGESALEAGEDEEEVWLFWRAGHKEVRSKSVRELAQDAK
EGQKEDRDVLGYYRYQLNLFARMCLDRQYLAINEISGQLDVDLILRCMSDENLPYDLRAS
FCRLMLHMHVDRDPQEQVTPVKYARLWSEIPSEIAIDDYDSSGTSKDEMKERFAQTMGFV
EEYLRDVVCQRFPFSDKEKNKLTFEVVNLARNLIYFGFYNFSDLLRLTKILLAILDCVHV
TTIFPITKMAKGDENKGSNVMRSIHGVGELMTQVVLRGGGFLPVAPMAAAPEGNVKQAEP
EKEDIMVMDTKLKIIEILQFILNVRLDYRISCLLCIFKREFDESNSQTSETSSGSSSQEG
PGSVPGALDFEHIEEQAEGIFGGSEENTPLDLDDHGGRTFLRVLLHLTMHDYPPLVSGAL
QLLFRHFSQRQEVLQAFKQVQLLVTSQDVDNYKQIKQDLDQLRSIVEKSELWVYKGQGPD
EAMEGPSGENEHKKTEEGNNKSQKHESTSSYNYRVVKEILVRLSKLCVQESASVRKSRKQ
QQRLLRNMSAHAVVLELLQIPYEKAEDTKMQEIMRLAHEFLQNFCAGNQQNQALLHKHIN
LFLNPGILEAVTMQHIFMNNFQLCSEINERVVQHFVHCIETHGRNVQYIKFLQTIVKAEG
KFIKKCQDMVMAELVNSGEDVLVFYNDRASFQTLIQMMRSERDRMDENSPLMYHIHLVEL
LAVCTEGKNVYTEIKCNSLLPLDDIVRVVTHEDCIPEVKIAYINFLNHCYVDTEVEMKEI
YTSNHMWKLFENFLVDICRACNNTSDRKHADSVLEKYVTEIVMSIVTTFFSSPFSDQSTT
LQTRQPVFVQLLQGVFRVYHCNWLVPSQKASVESCIRVLSDVAKSRAIAIPVDLDSQVNN
LFLKSHNIVQKTAMSWRLSARNAARRDSVLAASRDYRNIIERLQDIVSALEDRLRPLVQA
ELSVLVDVLHRPELLFPENTDARRKCESGGFICKLIKHTKQLLEENEEKLCIKVLQTLRE
MMTKDRGYGEKLISIDELDNAELPQAPDSENATEQEQEPSPPLRQLEDHKRGEALRQILV
NRYYGNIRPSGRRESLTSFGNGPLSPGGPSKPGGGGGGSGSSAVSRAEMSLADVQCHLDK
EGASNLVIDLIMNASSDRVFHESILLAIALLEGGNTTIQHSFFCRLTEDKKSEKFFKVFY
DRMKVAQQEIKATVTVNTSDLGNKKKDDEVDRDAPSRKKAKEPVTQITEEVRDQLLEASA
ATRKAFSAFRREADPDDHYQPGEGAQAAADKAKDDLEMSAVVTIMQPILRFLQLLCENHN
RDLQNFLRCQNNKTNYNLVCETLQFLDCICGSTTGGLGLLGLYINEKNVALINQTLESLT
EYCQGPCHENQNCIATHESNGIDIITALILNDINPLGKKRMDLVLELKNNASKLLLAIME
SRHDSENAERILYNMRPKELVEVIKKAYMQGEVEFEDGENGEEGAASPRNVGHNIYILAH
QLARHNKELQSMLKPGGQVDGDAALGFYAKHTAQIEIVRQDRTMEQIVFPVPSICEFLTK
ESKLRIYYTTERDEQGSKINDFFLRSEDLFNEMNWQKKLRAQPVLYWCARNMSFWSSISF
NLAVLMNLLVAFFYPFRGVRGGTLEPHWSGLLWTAMLVSLAIVVALPKPHGVRALIASTI
LRLIFSVGLQPTLFLLGAFNVCNKIIFLMSFVGNCGTFTRGYRAMVLDVEFLYHLLYLLI
CAMGLFVHEFFYSLLLFDLVYREETLLNVIKSVTRNGRSIILTAVLALILVYLFSIVGYL
FFKDDFILEVDRLPNDTALPDAGESLASEFLHSDVCRVETGENCSPTAPQEELPPAEETE
QDQEHTCETLLMCIVTVLSHGLRSGGGVGDVLRKPSKEEPLFAARVIYDLLFFFMVIIIV
LNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVTFEEHIQEEHNMWHY
LCFIVLVKVKDSTEYTGPESYVAEMIKERNLDWFPRMRAMSLVSSDSEGEQNELRNLQEK
LESTMKLVTNLSGQLSELKDQMTEQRKQKQRIGLLGHPPHMNVNPQQPA
NT seq 8250 nt   +upstreamnt  +downstreamnt
atgtccgacaagatgtctagtttcctacacattggagacatttgttctctgtatgcggag
ggatcgacaaatggattcattagcacgttggggctggtcgacgatcgctgcgttgtgcag
ccggaagccggggacctcaacaacccacccaagaagttccgagactgcctcttcaagctg
tgtcccatgaaccgctactccgcccagaagcagttctggaaagcggccaagccgggggcc
aacagcacgacggacgcggtgctgctcaacaagctgcaccacgcggcggacttggagaag
aagcagaacgagacggaaaacaggaagctgctggggacggtcatccagtacggcaacgtg
atccagctcctgcatctgaaaagcaacaagtacctgaccgtgaacaagaggctcccggcc
ctgctggagaagaatgccatgcgggtgacgctggacgaggccggcaacgaggggtcctgg
ttttacatccagcccttctacaagctgcggtccatcggcgacagcgtggtcataggcgac
aaggttgttctgaaccccgtcaatgcgggccagcccctccacgccagcagccatcagctg
gtggacaacccggggtgcaatgaggtcaactccgtcaactgcaacacgagctggaagatc
gtcctcttcatgaagtggagtgacaacaaggacgacatactgaaggggggcgacgtggtg
cggctgttccacgccgagcaggagaagttcctcacgtgtgacgagcaccggaagaagcag
cacgtcttcctgaggaccaccggccgccagtcggccacgtcggccaccagctccaaagcc
ctgtgggaagtggaggtggtccagcacgacccgtgccgcggaggagcggggtactggaac
agcctcttccgcttcaagcatctggccacggggcattacttagcagcagaggtagaccct
gactttgaggaagagtgcctggagtttcagcccccagcggaccccgaccaggacgcctct
cggggcaggctgcggaacgcccaggagaagatgctgtactccctggtctccgtgcccgag
ggcagcgacatctcctccatcttcgagctcgaccccaccactctgcgcggaggcgacagc
cttgtgccgagaaactcgtatgtccggcttagacatctgtgtactaacacctgggttcac
agcacaaacatccccatcgacaaggaggaagaaaaacccgtgatgctgaaaatcggcacc
tcgcccgtgaaggaggacaaggaggcgttcgccatcgtcccggtctcccctgcggaggtt
cgggacctggactttgccaatgacgccagcaaggtgctgggctccatcgccgggaagctg
gagaaaggcaccatcacccagaacgaaaggaggtcggtcaccaagctgctggaagacttg
gtttacttcgtcacgggtggcaccaactctgggcaggacgtccttgaggtggtcttctcc
aagcccaacagggagcggcagaagctgatgcgcgagcagaacatcctcaagcagatcttc
aagctgctgcaggcgccgttcacggactgcggggacggcccgatgctgcggctggaggag
ctgggggaccagcggcacgcgcccttcagacacatctgccgcctgtgctaccgcgtgctg
cggcactcgcagcaggactacaggaagaaccaggagtacattgccaagcagttcggcttc
atgcagaagcagatcggctacgacgtgctggccgaggacaccatcaccgccctgctgcac
aacaatcggaagctgctggagaagcacatcaccgcggccgagatcgacaccttcgtcagc
ctggtgcggaagaacagggagcccagattcttagattacctgtccgacctctgcgtgtcc
acgaacaagtcgatccccgtgacccaggagctgatatgtaaggctgtactgaaccccacc
aacgccgacatcctcatcgagaccaagctggtcctgtctcgatttgagttcgagggcgtc
tccacgggagagagcgccctggaggcgggtgaggacgaggaggaggtgtggctcttctgg
agggctggccacaaggaggtccgcagcaagagcgtgcgggagctggcccaggacgccaag
gagggccagaaggaggaccgggacgtgctcggctactaccggtaccagctgaacctcttt
gccaggatgtgtctggaccgccagtacctggccatcaacgagatctcgggccagctggac
gtggacctcatcctgcgctgcatgtcagacgagaacctgccctacgacctcagggcgtcc
ttctgccggctcatgctgcacatgcatgtggaccgagacccccaggagcaagtcaccccc
gtgaagtatgcccgcctgtggtcggagatcccgtccgagatcgccattgacgactacgac
agcagcggaacttccaaagatgagatgaaggagaggtttgcccagaccatgggcttcgtg
gaggagtacttgagagacgtggtttgccagaggtttcccttctctgacaaggagaagaat
aagcttacgttcgaggttgtgaatttagctaggaatctcatctactttggtttctacaac
ttctctgaccttctgcgattaaccaaaatcctcctggccatattggactgtgtgcacgtg
acgacgatcttccccatcaccaagatggccaagggagacgagaataagggcagcaacgtg
atgcggtccatccacggggttggagagctcatgacccaggtggtgctgcggggcgggggc
ttcctgcccgtggcccccatggctgccgcccccgagggcaacgtgaagcaggccgagccg
gaaaaggaggacatcatggtcatggacaccaagctgaagatcatcgagatactccagttc
attctcaacgtgcggctggactacaggatctcctgcctcctgtgcatattcaagcgggag
tttgacgagagcaattcccagacttcggagacgtcctcgggaagcagcagccaggagggg
cccggcagcgtgccaggtgctcttgactttgaacatattgaagaacaggcagaaggcatc
ttcggaggaagcgaggagaacacccccctggacctggatgaccacggcggcagaaccttc
ctccgtgtcctgctgcacctgacgatgcacgactaccccccgctggtgtcgggggccctg
cagctgcttttccggcacttcagccagaggcaggaggtgctgcaggccttcaagcaggtt
caactgcttgttaccagccaagacgtcgacaactacaaacagatcaaacaggacttggac
cagctgagatccatcgtggagaagtcggagctgtgggtgtacaaagggcagggccccgac
gaggccatggagggcccgtctggagagaatgagcacaagaagaccgaggaggggaataac
aagtcacagaagcacgagagcaccagcagctacaactacagggtggtgaaggagatcctg
gtccggctcagcaagctgtgcgtgcaggagagcgcgtccgtgcgcaagagccgcaagcag
cagcagcgcctgctgcggaacatgagcgcgcacgcggtggtgctggagctgctgcagatc
ccctacgagaaggccgaggacaccaagatgcaggagataatgaggctggcgcatgagttt
ctgcagaacttctgtgcgggcaaccagcagaaccaggccctgctgcacaagcacataaac
ctgttcctcaaccccgggatcctggaggccgtgacgatgcagcacatcttcatgaacaac
ttccagctgtgcagcgagatcaacgagcgggtcgtgcagcacttcgtccactgcatcgag
acgcacggccgcaacgtgcagtacatcaagttcctgcagacgatcgtcaaggccgaaggc
aaattcatcaagaagtgccaagacatggtcatggctgagctggtgaactcgggcgaggac
gtcctcgtgttctacaacgacagagcctctttccagaccctgatccagatgatgcgctcc
gaacgggaccggatggacgagaacagcccgctcatgtaccacatccacctggtcgagctg
ctggccgtgtgcacggagggcaagaacgtgtacactgagatcaagtgcaactccctgctg
ccgctggacgacatcgtccgcgtggtcacccacgaggactgcatccccgaggtgaaaatc
gcgtacattaacttcctcaatcactgctacgtggacacggaggtggagatgaaggagatc
tacaccagcaaccacatgtggaagctgttcgagaatttcctcgtggacatctgccgggcc
tgtaacaacaccagtgaccggaagcacgccgactcggttttggagaagtatgtgaccgag
attgtcatgagcatcgtgaccacgttcttcagctctcccttctcagaccagagcacgact
ctgcagacccgccagcccgtcttcgtgcagctgctgcaaggcgtcttccgggtttaccac
tgcaactggctggtgccgagccagaaagcgtccgtggagagctgcatccgggtgctctct
gacgtggccaagagccgggccatcgccatccctgtggacctggacagccaagtcaacaac
ctcttcctgaagtcccacaacatcgtgcagaagaccgccatgagctggcggctgtccgcc
cgcaacgcggcccgcagggactccgtgctggcggcctccagagactatcggaacatcatc
gagagactgcaggacatcgtgtcggcgctggaggaccggctgcggcccctggtccaggcc
gagctgtccgtgctggtggacgttctgcacaggcccgagctgcttttccccgagaacacc
gacgccaggcggaagtgcgagagcggtggcttcatctgcaagctgatcaagcacacgaaa
cagctgctggaggagaacgaggagaaactctgcatcaaagtcctgcagaccctccgcgaa
atgatgaccaaggacagaggctacggagagaagctaatttccattgatgaattggataat
gccgagctgccacaggctccggattctgagaacgccacagagcaggagcaggagccaagt
ccacccctgaggcagctggaagaccataaaaggggtgaggcgctcaggcaaattttggtc
aaccgttactatggaaacatcagaccttcgggaagaagagagagccttaccagctttggc
aatggcccgctgtcaccaggaggacccagcaagcccgggggaggagggggaggctccggg
tccagcgccgtgagcagagctgagatgagcctggccgacgtccagtgccacctcgacaag
gagggggcctccaacctggtcatcgacctcataatgaacgcttccagtgaccgcgtgttc
cacgagagcatcctcctggccatcgcccttctggaagggggcaataccaccatacagcat
tcctttttctgccgactaacagaggacaagaagtcggagaaattcttcaaggtcttctat
gaccgaatgaaggtggcccagcaagagatcaaggcgacggtgacggtgaacaccagtgac
ttggggaataaaaagaaagatgacgaggtcgacagagacgccccgtcacggaagaaagcc
aaagagcccgtgacacagataacggaggaggtccgcgaccagctgctggaggcctccgcc
gccaccaggaaggccttctccgccttccggagggaggctgaccccgacgaccactaccag
cccggcgagggcgcccaggccgcggcggacaaggccaaggatgacctggagatgagcgcg
gtcgtcaccatcatgcagcccatcctgcgcttcctgcagctgctgtgcgagaaccacaac
cgggacctgcagaacttcctccgttgccaaaacaacaagaccaactacaacctggtgtgc
gagaccctgcagttcctggactgcatctgcggcagcaccaccggcggcctcggcctgctc
gggctctacatcaacgagaagaacgtcgccctcatcaaccagaccctggagagcctcacc
gagtactgccaggggccctgccacgagaaccagaactgcatcgccacccacgagtccaac
ggcattgacatcatcaccgccctgatccttaacgacatcaatcctttgggaaagaagagg
atggacctcgtgttggagctgaagaacaacgcctccaagctgctgctggccatcatggag
agcaggcacgacagcgagaacgccgagaggatcctgtacaacatgcggccgaaggagctg
gtggaagtgatcaagaaagcctacatgcagggcgaggtggagttcgaggacggcgagaac
ggcgaggagggggccgcctcccccaggaacgtggggcacaacatctatatcttagcccac
cagctggcccggcacaacaaggagctgcagagcatgctgaagcccggcggccaggtggac
ggggacgcggccctggggttctacgccaagcacacggcccagatagagatcgtcaggcag
gaccgcaccatggagcagatcgtgttccccgtgcccagcatctgcgagttcctcaccaag
gagtcgaagctgcgcatctactacaccacggagcgggacgagcagggcagcaagatcaac
gacttcttcctgcgctccgaggacctgttcaacgagatgaactggcagaagaagctgcga
gcccagcccgtgctgtactggtgtgcccgcaacatgtccttctggagcagcatctcgttc
aacctggccgtcctcatgaacctgctcgtggccttcttctacccgttcagaggagtccga
ggagggaccctggagccgcactggtcgggactgctgtggacagccatgctcgtctctctg
gccatcgtggtcgccctgcccaagccccacggcgtccgagccttaatcgcctccacaatc
ctgcggctcatattttcggtcgggctgcagcccacgctgttccttctgggcgcgttcaac
gtctgcaataaaatcatcttcctcatgagcttcgtgggcaactgcgggacgttcaccagg
ggctaccgggccatggtgctggacgtcgagttcctctatcacctgctgtacctcctcatc
tgcgccatggggctcttcgtgcacgagttcttctacagcctgctgctcttcgacttagtg
tacagggaggagaccctgctcaacgtcatcaagagcgtcacgcgcaacgggcggtccatc
atcctgacggcggtgctggctctgatcctggtctacctgttctccatcgtgggctatctg
ttcttcaaggacgacttcatcctggaagtggacaggctgcccaacgacacggctctccca
gacgccggcgagagtttggcgagcgagttcctgcactcggacgtgtgtcgggtggagacc
ggggagaactgctcccccacagcaccccaggaagagctgcccccggccgaggagacggag
caggaccaggagcacacgtgtgagacgctgctcatgtgcatcgtcactgtgctgagccac
gggctgcggagcgggggcggcgtgggcgacgtgctcaggaagccgtccaaagaggagccc
ctctttgccgcgagggtcatctacgacctcctgttcttcttcatggtcatcatcatcgtc
cttaacctcattttcggggtcatcatcgacacctttgcggacctgcggagcgagaagcag
aagaaagaggagatcttgaagacgacatgcttcatctgtggcttagaaagagacaagttc
gacaacaagacggtcaccttcgaagagcacatccaggaggagcacaacatgtggcactac
ctgtgcttcatcgtcctcgtgaaggtcaaggactccacggagtacacggggccggagagc
tacgtggccgagatgatcaaggaaaggaacctggactggttccccaggatgcgagccatg
tccttggtcagcagcgactccgaaggggagcagaatgagctgaggaacctgcaggagaag
ctggagtccaccatgaagctggtcaccaacctgtccggccagctgtcagagctcaaggac
cagatgacagaacaaaggaagcagaaacagagaatcggcctcctggggcacccccctcac
atgaacgtcaacccgcagcagccggcctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107511965
Entry
107511965         CDS       T06036                                 

Gene name
ITPR3
Definition
(RefSeq) LOW QUALITY PROTEIN: inositol 1,4,5-trisphosphate receptor type 3
  KO
K04960  inositol 1,4,5-triphosphate receptor type 3
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04020  Calcium signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04070  Phosphatidylinositol signaling system
ray04114  Oocyte meiosis
ray04210  Apoptosis
ray04218  Cellular senescence
ray04270  Vascular smooth muscle contraction
ray04371  Apelin signaling pathway
ray04540  Gap junction
ray04611  Platelet activation
ray04621  NOD-like receptor signaling pathway
ray04625  C-type lectin receptor signaling pathway
ray04713  Circadian entrainment
ray04720  Long-term potentiation
ray04723  Retrograde endocannabinoid signaling
ray04724  Glutamatergic synapse
ray04725  Cholinergic synapse
ray04726  Serotonergic synapse
ray04728  Dopaminergic synapse
ray04730  Long-term depression
ray04742  Taste transduction
ray04750  Inflammatory mediator regulation of TRP channels
ray04911  Insulin secretion
ray04912  GnRH signaling pathway
ray04915  Estrogen signaling pathway
ray04918  Thyroid hormone synthesis
ray04921  Oxytocin signaling pathway
ray04922  Glucagon signaling pathway
ray04924  Renin secretion
ray04925  Aldosterone synthesis and secretion
ray04927  Cortisol synthesis and secretion
ray04928  Parathyroid hormone synthesis, secretion and action
ray04929  GnRH secretion
ray04934  Cushing syndrome
ray04935  Growth hormone synthesis, secretion and action
ray04970  Salivary secretion
ray04971  Gastric acid secretion
ray04972  Pancreatic secretion
ray05010  Alzheimer disease
ray05012  Parkinson disease
ray05014  Amyotrophic lateral sclerosis
ray05017  Spinocerebellar ataxia
ray05020  Prion disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05163  Human cytomegalovirus infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05170  Human immunodeficiency virus 1 infection
ray05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107511965 (ITPR3)
   04020 Calcium signaling pathway
    107511965 (ITPR3)
   04070 Phosphatidylinositol signaling system
    107511965 (ITPR3)
   04022 cGMP-PKG signaling pathway
    107511965 (ITPR3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107511965 (ITPR3)
   04210 Apoptosis
    107511965 (ITPR3)
   04218 Cellular senescence
    107511965 (ITPR3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107511965 (ITPR3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107511965 (ITPR3)
   04621 NOD-like receptor signaling pathway
    107511965 (ITPR3)
   04625 C-type lectin receptor signaling pathway
    107511965 (ITPR3)
  09152 Endocrine system
   04911 Insulin secretion
    107511965 (ITPR3)
   04922 Glucagon signaling pathway
    107511965 (ITPR3)
   04929 GnRH secretion
    107511965 (ITPR3)
   04912 GnRH signaling pathway
    107511965 (ITPR3)
   04915 Estrogen signaling pathway
    107511965 (ITPR3)
   04921 Oxytocin signaling pathway
    107511965 (ITPR3)
   04935 Growth hormone synthesis, secretion and action
    107511965 (ITPR3)
   04918 Thyroid hormone synthesis
    107511965 (ITPR3)
   04928 Parathyroid hormone synthesis, secretion and action
    107511965 (ITPR3)
   04924 Renin secretion
    107511965 (ITPR3)
   04925 Aldosterone synthesis and secretion
    107511965 (ITPR3)
   04927 Cortisol synthesis and secretion
    107511965 (ITPR3)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107511965 (ITPR3)
  09154 Digestive system
   04970 Salivary secretion
    107511965 (ITPR3)
   04971 Gastric acid secretion
    107511965 (ITPR3)
   04972 Pancreatic secretion
    107511965 (ITPR3)
  09156 Nervous system
   04724 Glutamatergic synapse
    107511965 (ITPR3)
   04725 Cholinergic synapse
    107511965 (ITPR3)
   04728 Dopaminergic synapse
    107511965 (ITPR3)
   04726 Serotonergic synapse
    107511965 (ITPR3)
   04720 Long-term potentiation
    107511965 (ITPR3)
   04730 Long-term depression
    107511965 (ITPR3)
   04723 Retrograde endocannabinoid signaling
    107511965 (ITPR3)
  09157 Sensory system
   04742 Taste transduction
    107511965 (ITPR3)
   04750 Inflammatory mediator regulation of TRP channels
    107511965 (ITPR3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107511965 (ITPR3)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    107511965 (ITPR3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107511965 (ITPR3)
   05012 Parkinson disease
    107511965 (ITPR3)
   05014 Amyotrophic lateral sclerosis
    107511965 (ITPR3)
   05017 Spinocerebellar ataxia
    107511965 (ITPR3)
   05020 Prion disease
    107511965 (ITPR3)
   05022 Pathways of neurodegeneration - multiple diseases
    107511965 (ITPR3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107511965 (ITPR3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107511965 (ITPR3)
   05163 Human cytomegalovirus infection
    107511965 (ITPR3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107511965 (ITPR3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107511965 (ITPR3)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107511965 (ITPR3)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107511965 (ITPR3)
Ion channels [BR:ray04040]
 Ligand-gated channels
  IP3 receptor
   107511965 (ITPR3)
SSDB
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans
Other DBs
NCBI-GeneID: 107511965
NCBI-ProteinID: XP_016002453
LinkDB
Position
Unknown
AA seq 2671 aa
MSEMSSFLHIGDIVSLYAEGSVNGFISTLGLVDDRCVVEPAAGDLDNPPKKFRDCLFKVC
PMNRYSAQKQYWKAKQTKQDKEKIADVVLLQKLQHAAQMEQKQNDTENKKVHGDIVKYGS
VIQLLHMKSNKYLTVNKRLPALLEKNAMRVTLDATGNEGSWLFIQPFWKLRSNGDNVVVG
DKVILNPVNAGQPLHASNYELSDNAGCKEVNSVNCNTSWKINLFMQFRDHMDEVLKGGDV
VRLFHAEQEKFLTCDEYKGKLQVFLRTTLRQSATSATSSNALWEVEVVHHDPCRGGAGHW
NGLYRFKHLATGNYLAAEENPGYKGDASDPKAAGVGVQGRVGRRNAGEKIKYRLVAVPHG
NDIASLFELDPTTLQKTDSFVPRNSYVRLRHLCTNTWIQSTNVPIDVEEERPIRLMLGTC
PTKEDKEAFAIVSVPVSEIRDLDFANDASSMLASAVEKLNEGFISQNDRRFVIQLLEDLV
FFVSDVPNNGQNVLDIMVPKPNRERQKLMREQNILKQIFGILKAPFRDKGGEGPLVRLEE
LSDQKNAPYQHMFRLCYRVLRHSQEDYRKNQEHIAKQFGMMQSQIGYDILAEDTITALLH
NNRKLLEKHITKTEVETFVSLVRKNREPRFLDYLSDLCVSNHIAIPVTQELICKCVLDPK
NSDILIQTELRPVKEMAQAHEYLTIEYSDEEVWLTWTDKNNEHHEKSVRQLAQEARAGNA
HDENVLSYYRYQLKLFARMCLDRQYLAIDEISQQLGVELIFLCMADEMLPFDLRASFCHL
MLHVHVDRDPQELVTPVKFARLWTEIPTAITIKDYDSNLNAARDDKKNKFASTMEFVEDY
LNNVVSEAVPFANEEKNKLTFEVVSLAHNLIYFGFYSFSELLRLTRTLLGIIDCVQGPPA
MLQAYEDPGGKNVRRSIQGVGHMMSTMVLNRKQSVFGAPSLPGGAGAAEPLDRSKFEENE
DIVVMETKLKILEILQFILNVRLDYRISYLLSVFKKEFVEVFPMQDSGADGTAPAFDSTT
ANMNLDRIGEQAEAMFGVGKTSSMLEVDDEGGRMFLRVLIHLTMHDYAPLVSGALQLLFK
HFSQRQEAMHTFKQVQLLISAQDVENYKVIKSELDRLRTMVEKSELWVDKKGSGKGEEVE
TGASKDKKERPTDEEGFLPPPGEKSSENYQIVRGILERLNKMCGVGEQMRKKQQRLLKNM
DAHKVMLDLLQIPYDKGDTKMMEILRYTHQFLQKFCAGNPGNQTLLHKHLHLFLTPGLLE
AETMQHIFLNNYQLCSEVNEPVLQHFVHLLATHGRHVQYLDFLHTVIKAEGKYVKKCQDM
IMTELTNAGDDVVVFYNDKASLAHLLDMMKAARDGVEDHSPLMYHISLVDLLAACAEGKN
VYTEIKCTSLLPLEDVVSVVTHEDCITEVKMAYVNFVNHCYVDTEVEMKEIYTSNHIWTL
FENFTLDMARVCSKREKRLADPTLEKYVLTVVLDTINAFFSSPFSENSTSLQTHQTIVVQ
LLQSTTRLLECPWLQQQHKGSVEACIRTLAMVAKGRAISLPMDLDAHISLLLSSGATCVA
AAQRNASHYKAATRAFPRVTPTANQWDYKNIIEKLQDIITALEERLKPLVQAELSVLVDV
LHWPELLFLEGSEAYQRCESGGFLSKLIQHTKDLMVSEEKLCVKVLRTLQQMLLKKTKYG
DRGNQLRKMLLQNYLQNRKSGSRGDLPDPMGTGLDQDCSAIAATQCRLDKEGATKLVCDL
ITSTKNEKIFQESIGLAIRLLDGGNTEIQKSFYNLMTSDKKSERFFKVLHDRMKRAQQET
KSTVAVNMSDLGSQPHEDREPADPTAKGRVASFSMPGSSSLYSLSPSLRRGHEVGERVQS
NEMGMSVLIMQPILRFLQLLCENHNRDLQNFLRCQNNKTNYNLVCETLQFLDIMCGSTTG
GLGLLGLYINEDNVGLVIQTLETLTEYCQGPCHENQTCIVTHESNGIDIITALILNDISP
LCKYRMDLVLQLKDNASKLLLALMESRHDSENAERILISLRPQELVDVIKKAYLQEEERE
NSEVSPREVGHNIYILALQLSRHNKQLQHLLKPVKRIQEEEAEGISSMLSLNNKQLSQML
KSSPPVQEEEEDPLAYYENHTSQIEIVRQDRSMEQIVFPVPGICQFLTEETKHRLFTTTE
QDEQGSKVSDFFDQSSFLHNEMEWQRKLRSMPLIYWFSRRMTLWGSISFNLAVFINIIIA
FFYPYVESTSTGALDSPLIWLLFWILICFSITALFTKRYSIRPLIVALILRSIYYLGIGP
TLNILGALNLTNKIVFVVSFVGNRGTFIRGYKAMIMDVEFLYHVGYILTSVLGLFAHELF
YSILLFDLIYREETLFNVIKSVTRNGRSILLTALLALILVYLFSIVGFLFLKDDFILEVD
PLPGNHSRASPLGMPHGAATFMGTCSGDSIDCVSGVSMPQVLEEDEELDNTERACDTLLM
CIVTVMNHGLRNGGGVGDILRKPSKDESLFPARVVYDLLFFFIVIIIVLNLIFGVIIDTF
ADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFEEHIKFEHNMWNYLYFIVLVRVKNK
TDYTGPESYVAQMIKNKNLDWFPRMRAMSLVSNEGEGEQNEIRILQDKLNSTMKLVSYLT
AQLNELKEQMTEQRKRRQRLGFVDVQNCMSR
NT seq 8016 nt   +upstreamnt  +downstreamnt
atgagcgagatgtcgagctttcttcacatcggagacatagtctccctgtacgccgagggc
tcggtcaatggcttcatcagcactttggggctggtggatgaccgctgtgtggtggaaccc
gcagctggggacctggacaacccccctaagaagttccgagactgcctcttcaaggtgtgc
cccatgaaccgctactcagcccagaagcagtactggaaggccaaacagaccaagcaggac
aaggagaagattgccgatgtggtgctgctgcagaagttgcagcatgcagcccaaatggag
cagaagcagaatgacacagagaacaagaaggtgcatggggacattgtgaagtatggcagt
gtgatccagctcctgcacatgaaaagcaacaagtacctgacagtgaacaagcggctgccg
gccctgctggagaagaatgccatgcgggtgacgctggatgccacgggcaatgagggctcc
tggctcttcatccagcctttctggaagctgcggagcaatggggacaatgtggttgtgggg
gacaaggtgatcctgaatcccgtcaatgctgggcagcctctgcatgccagtaattacgag
ctcagcgacaatgctggctgcaaggaggtcaactctgtgaactgcaacaccagctggaag
atcaacctctttatgcagttccgagaccacatggatgaggtgttgaaagggggagacgtg
gtgcggctgttccatgcggagcaggagaagttcctgacttgtgatgagtacaagggcaag
ctgcaggtgttcctgcgtaccacgctgcgccagtctgccacctcggccaccagctccaac
gccctctgggaggtggaggtggtccaccatgacccctgtcgtggaggagctggccactgg
aatggcctgtaccgcttcaagcacctggccacaggcaactacttggctgctgaggagaac
cctggctacaagggtgatgcctctgatcccaaggcagcaggagtgggtgtgcagggccgt
gtaggtcgccggaacgctggggagaagatcaagtaccgccttgtggctgtgcctcatggc
aacgacatcgcctcgctctttgagctggaccccaccacattgcagaagactgactctttt
gtgccccgaaactcgtatgtccggctgcggcacctctgcaccaacacgtggatccagagc
accaacgtgcccatcgacgtcgaggaggagcggcccatccggctcatgctaggcacctgt
cccaccaaggaggacaaggaggcctttgccatcgtgtcagttcctgtgtccgagatccga
gacctggactttgccaacgatgccagctccatgttggccagtgccgtggagaaactgaat
gagggcttcatcagccagaatgaccgaaggtttgtcatccagctgctggaggacctggtg
ttctttgtcagcgatgtccccaacaatgggcagaacgtcctcgacatcatggtccccaag
cccaaccgggaacggcagaagctgatgagggagcagaacatcctcaaacagatctttggc
attctgaaggctccgttccgtgacaaggggggtgaggggcccctggtgcggctggaggag
ctgtcggaccagaagaacgccccctaccagcacatgttccgcctgtgctaccgggtgctg
cggcattcccaggaggactaccgcaagaaccaggagcacatcgctaagcagtttgggatg
atgcagtcccagatcggctacgacatcttggctgaagacaccatcactgccctgctgcac
aacaaccgcaagctcctggagaaacacatcaccaaaaccgaggtggagaccttcgtcagc
ctggtgcggaagaaccgggagcccaggttcctggactacctctccgacctgtgtgtatcc
aaccacattgccattcctgtcacccaggagctcatctgcaagtgtgtgctggaccccaag
aacagtgacattctcattcagaccgaacttcggccggtgaaggagatggcccaggcccac
gagtacctgaccatcgagtactcagatgaggaggtgtggctcacgtggactgacaagaat
aatgagcaccatgagaagagtgtgaggcagctggcccaggaggcccgggctggcaatgcc
cacgacgagaatgtgctcagctactacaggtaccagctgaagctctttgcccgcatgtgc
ctggaccgacagtatctggccatagatgagatctcccagcagctgggcgttgaactgatc
ttcctgtgcatggcggatgagatgctgccttttgacctgcgcgcctccttctgccacctg
atgctgcatgtgcatgtggaccgtgacccccaggagctggtcacacctgtcaagtttgcc
cgcctctggacagagatccccacagccatcaccatcaaggactatgattccaacctcaat
gccgcacgagatgacaagaagaacaagtttgccagcaccatggagttcgtggaggactac
ctcaacaatgtggtcagcgaggccgtgccctttgccaatgaggagaagaacaagctcacc
ttcgaggtggtcagcctggcgcacaatctcatctatttcggcttctacagcttcagtgag
ctactgcggctcacacgcaccttgctcggcatcatcgactgtgtgcagggccccccagcc
atgctgcaggcctacgaagacccaggtggtaagaacgtgcggcggtccatccagggtgtg
ggccacatgatgtccaccatggtgctgaaccgcaagcagtctgtctttggcgccccaagt
ctgcctggtggtgctggggctgctgagccgctggatagaagcaaattcgaggagaatgaa
gacattgtggtgatggagaccaagttgaagatcctggaaatcctgcagttcatcctcaac
gtccgcctggattaccgcatctcctacctgctgtccgtcttcaagaaggagtttgtggag
gtgtttcccatgcaggacagtggagctgatggcacagcccctgccttcgactctaccact
gccaacatgaacctggatcgcattggggagcaggcagaggccatgttcggagtggggaag
acaagcagcatgctggaggtggacgacgagggcggtcgtatgttcctgcgggtgctcatc
cacctcaccatgcatgactacgcgccgctggtctccggggccctgcagctgctcttcaag
cacttcagccagcgccaggaggccatgcacaccttcaagcaggtgcagctgctgatctca
gcccaggatgtggagaactacaaggtgatcaagtcggagctggaccggctgcggactatg
gtcgagaagtcagagctgtgggtggacaagaagggcagcggcaagggtgaggaggtggag
acaggtgcttccaaagacaagaaggagcggcccacggatgaggaaggatttctgcccccg
cctggggagaagagcagtgagaactaccagatcgtcaggggcattctagagcggctgaac
aagatgtgtggtgttggggaacagatgaggaagaagcagcagaggctactcaagaacatg
gatgcccacaaggtcatgctggacctgctgcagatcccctacgacaagggcgataccaag
atgatggagatcctacgctacacacaccagttcctgcagaagttctgcgcggggaaccct
ggcaaccagaccctgctacacaagcacctgcacctcttcctcacgccagggctcctggag
gcagagaccatgcagcacatcttcctgaacaactatcagctctgctctgaggtcaacgag
cccgtgttgcagcactttgtgcacctgctggccacccacgggcgccacgtacaatactta
gacttcctgcacactgtcatcaaggccgagggcaagtacgtcaagaagtgccaggacatg
atcatgactgagctgaccaacgcaggtgatgacgtggtcgtgttctacaatgacaaggcc
tcgctggctcacctgctggatatgatgaaggccgcccgggacggtgtggaggaccacagc
cccctcatgtaccacatctccctggtggacctgctggctgcctgtgccgagggcaagaat
gtctatactgagatcaagtgcacctccctcctgcccttggaggacgtggtgtctgtggtc
acgcatgaagactgcatcactgaggtgaaaatggcctacgtgaactttgtgaaccactgc
tacgtggacacggaggtggaaatgaaggagatctacaccagcaaccacatctggaccctc
tttgagaacttcaccctggacatggctcgggtctgcagtaagcgggagaagcgtctggct
gaccctaccctggagaagtacgtgctgaccgtcgtgctggacaccatcaatgccttcttc
agctccccgttctctgaaaacagcacctccttacagacacaccagacaatcgtggtgcag
ctgctgcagtccaccacacggctgctcgagtgtccgtggctgcagcagcagcacaagggc
tccgtggaggcctgcatccggaccctcgccatggtggccaagggccgggccatctcgctg
cccatggacctggacgcccacatcagcctgctgctcagcagtggcgccacctgtgtggct
gctgcccagcggaacgcttcccactacaaggcagccacgagggccttccccagagtcacc
cccaccgccaaccagtgggactacaagaacatcattgagaagctgcaggacatcatcaca
gccctggaggagcgcctgaagcccctggtgcaggccgagctgtctgtgctggtggacgtc
ctgcactggccggagctgctcttcttggagggcagtgaggcttaccagcgatgcgagagt
gggggcttcttgtccaagctgatccagcacaccaaggacctcatggtgtcggaggagaaa
ctgtgtgtcaaggtgctgcggaccctgcagcagatgctactcaagaagaccaagtatggg
gaccggggcaaccagctgcgcaagatgctactgcagaactacctccagaaccgcaagtct
ggctctcggggggaccttccggaccccatgggcaccggcctggaccaagactgctcagca
atcgcagccacccagtgccggctggacaaggagggagccaccaagctggtgtgtgacctc
atcaccagcaccaagaatgagaagatcttccaggagagcattggcctggccatccgcctg
ctcgatggtggcaatactgagatccagaaatccttctacaacctgatgactagtgacaag
aagtcagagcgcttcttcaaggtgctgcatgaccgcatgaagcgggcccagcaggagacc
aagtccacagtggctgtcaacatgagcgacctgggcagtcagccccatgaggaccgggag
ccagcagaccccactgccaaaggccgagtggcctccttctcaatgcctggctcctcatcc
ctctattcgctgagccccagcctgcgccgggggcatgaggtgggcgagcgtgtgcagagc
aacgagatgggcatgtccgtgctcatcatgcagcccatcctgcgctttctgcagctgttg
tgtgagaaccacaaccgggacctgcagaacttcctgcgctgccagaacaacaagaccaac
tacaacctggtgtgcgagacgctgcagttcttggacatcatgtgcggcagtaccacggga
ggcctggggctgctggggctctatatcaatgaggacaatgtgggtcttgtcatccagacc
ctggagaccctcactgaatactgccagggcccctgccacgagaaccagacctgcatcgtg
acgcatgagtccaatggcatagacatcatcactgcgctgattctcaatgacatcagtccc
ctgtgcaaatatcgtatggatctggtgctgcaactcaaggacaatgcctccaagctgctc
ctggctcttatggagagtcggcacgacagtgagaacgccgagcgcatcctcatcagcctg
cggccccaggagctggtggacgtcatcaagaaggcctacctgcaggaggaggagcgtgag
aactcagaggtgagcccacgtgaagtgggccacaatatctacatcctggcactgcagctc
tccaggcacaacaaacagctgcagcacctgctgaagcctgtgaagcgcatccaagaggag
gaggctgagggcatctcttccatgctcagcctcaacaacaagcagctgtcgcagatgctc
aagtcctcaccgcctgtgcaggaggaggaggaagaccccctggcctactatgagaaccac
acctcccagattgagatcgtgcggcaggatcgcagcatggagcagattgtgttcccagtg
cccggcatctgccagttcctgacagaggagaccaagcaccggctcttcaccaccacggag
caggatgagcagggcagcaaagtgagcgacttcttcgaccagtcctccttcctgcacaac
gagatggagtggcagcgcaagcttcgcagcatgccactgatctactggttctctcgccgc
atgactctgtggggcagcatctccttcaacctggcggtgtttattaacatcatcattgcc
ttcttctacccctatgtggagagcacatccacaggagcgctggactccccgctcatctgg
ctgctcttctggatcctcatctgcttctccatcacggccctgttcaccaagcgctacagc
atccgcccgctcattgtggcactcatcctgcgctccatctactacctgggcattgggccc
acactcaacatcctaggtgcccttaatctgaccaacaagattgtgttcgtggtgagcttc
gtgggtaaccgtggcacctttatccggggctataaggccatgatcatggacgtggagttc
ctctaccacgtgggctacatcctgactagtgtcctgggcctctttgcccatgagctcttc
tatagcatcctgctctttgacctcatctaccgtgaggagacactgttcaacgtcattaag
agcgtgacccgcaatggccgctccatcctgctgactgctctgttggccctcatcctcgtc
tacctcttctccatcgtcggcttcctcttccttaaggatgacttcatccttgaggttgac
ccactgcctggcaaccactctagagccagccctctggggatgccacatggagctgccacg
ttcatgggcacatgcagtggggacagcatagactgtgtctcgggggtctcaatgcctcaa
gtcttggaagaggatgaggagctggacaacacggagcgggcctgtgacaccctgctgatg
tgcatcgtcactgtcatgaaccatgggctgcgcaacggtggcggtgtgggcgacattctc
cgcaagccttccaaagacgagtctctattcccagcccgtgtggtctacgacctcctgttc
tttttcattgtcattatcattgtgctgaacctcatctttggagtgatcatcgacaccttt
gctgacctgcgcagtgagaagcagaagaaggaagagattctcaagaccacatgcttcatt
tgtggtctggagagggacaaatttgacaataaaacggtgtcatttgaggagcacatcaag
tttgagcacaacatgtggaactacctgtacttcatcgtgctggtccgtgtgaaaaacaag
acggactacacggggcccgagagctacgttgcccagatgatcaagaataagaacctggac
tggttcccccggatgagagccatgtcgctagtgagcaacgaaggggagggggagcagaat
gagatccggattcttcaggacaagcttaactccaccatgaagctggtgtcctacctcact
gctcagctcaacgagctcaaggagcagatgacagagcagcggaaacgcaggcaacgcctg
ggctttgtggatgtccagaactgcatgagccgctga

DBGET integrated database retrieval system