KEGG   Rousettus aegyptiacus (Egyptian rousette): 107497470
Entry
107497470         CDS       T06036                                 

Gene name
CAV1
Definition
(RefSeq) caveolin-1 isoform X1
  KO
K06278  caveolin 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04144  Endocytosis
ray04510  Focal adhesion
ray05020  Prion disease
ray05100  Bacterial invasion of epithelial cells
ray05205  Proteoglycans in cancer
ray05416  Viral myocarditis
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107497470 (CAV1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107497470 (CAV1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    107497470 (CAV1)
  09164 Neurodegenerative disease
   05020 Prion disease
    107497470 (CAV1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107497470 (CAV1)
   05416 Viral myocarditis
    107497470 (CAV1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    107497470 (CAV1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107497470 (CAV1)
Membrane trafficking [BR:ray04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    107497470 (CAV1)
SSDB
Motif
Pfam: Caveolin
Other DBs
NCBI-GeneID: 107497470
NCBI-ProteinID: XP_015974804
LinkDB
Position
Unknown
AA seq 178 aa
MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMTDEMNEKQVYDVHTKEIDLVNRDPKHLN
DDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFA
IVSFLHIWVVVPYIKSFLIEIQCISRVYSICIHTFCDPLFEATGKIFSNIRINMQKEI
NT seq 537 nt   +upstreamnt  +downstreamnt
atgtctgggggcaaatacgtagactccgagggacatctctacactgttcccatccgggaa
cagggcaacatctacaagcccaacaacaaggccatgacagacgaaatgaacgagaagcaa
gtgtacgacgtgcacaccaaggagatcgacctggtcaaccgcgaccccaagcatctcaac
gatgacgtggtcaagattgattttgaagatgtgattgcagaaccagaagggacacacagt
ttcgacggcatctggaaggccagcttcaccaccttcactgtgacgaaatattggttttat
cgcctgctgtctgccctcttcggcatccctatggcactcatctggggcatttacttcgcc
attgtttctttcctgcacatctgggtagtcgtaccgtacattaagagtttcctgattgag
attcagtgcatcagccgtgtctattccatctgcatccacaccttctgtgacccactcttt
gaggccactggcaaaatattcagcaatattcgtatcaacatgcagaaagaaatataa

DBGET integrated database retrieval system