KEGG   Rousettus aegyptiacus (Egyptian rousette): 107497476
Entry
107497476         CDS       T06036                                 

Gene name
SPDYC
Definition
(RefSeq) speedy protein C
  KO
K08694  speedy
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04114  Oocyte meiosis
ray04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107497476 (SPDYC)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107497476 (SPDYC)
SSDB
Motif
Pfam: Spy1
Other DBs
NCBI-GeneID: 107497476
NCBI-ProteinID: XP_015974812
LinkDB
Position
Unknown
AA seq 349 aa
MLRVISELRPPRFLLFQAPKSPPRSLRLPEGLCQTRLTNPFDLAGEEEGRCQVLGPVFLT
GHPPPPTLPAPTLHEMSDAQAPAQVVATQVKLWTWSRQDEGRVSLGSRQHQELQAFLGLL
EHSFLQEFLSRDPCFQISDKYLLAMVLVYFRRANLKLSEYTRSNLFLALYLANDMEEDLE
EAKCVIFPWALGKDWHCQVADFLRQRDKLWARMGFRAAVSCQCCEEIMAREPSHWAWTRE
RRPHHGGAQRSCPKAQVPLPRGPGLSPPYCSLCGLPPLCSHYCHQPCPLPVLPKCPSPNP
EWYRPPPHACLSVAEDPWRGGFLMVLPPQLHLEPGTYTLHILPKPPPVP
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgctgcgagtaatctctgagctcaggcctcccaggttccttctgttccaagcccccaag
tctccacccaggtccctccgccttccggagggcctttgtcagaccaggctcaccaacccc
tttgacttagcaggggaggaggagggaaggtgccaagtcctggggcccgttttcttgaca
ggtcacccacccccacccaccctacctgcccccaccctccatgagatgagtgacgcccaa
gcccctgcccaagtggtggccacccaagtgaagctgtggacctggagccgtcaggatgag
ggcagggtgtctctcggttcccgccagcaccaggagctccaggccttcctcggccttctg
gaacacagcttccttcaggagttcctctctagagatccctgtttccagatttcagataag
tatctcctggccatggtgctggtctacttccggcgcgccaacctgaagctcagcgagtat
acccgcagcaacttgttcttggcactgtaccttgcaaatgacatggaggaggacctggag
gaagccaaatgtgtgatttttccatgggccctgggcaaagattggcattgtcaggtggca
gacttcttgcgtcagagggacaagctgtgggcacggatgggcttccgggcggccgtgagc
tgccagtgctgtgaggagatcatggccagggagccgtcccactgggcctggactcgggaa
agacgcccccaccatggcggggcgcagaggagctgcccgaaggcccaggttcccctcccc
cggggccctggcctctcgccaccctactgttccctctgtggcttgccccctctctgcagc
cactactgccaccaaccctgccccttgcctgtcttacccaagtgcccgtccccaaaccct
gagtggtatcgccctcctccccatgcttgtctctcagtggctgaagacccttggagagga
ggcttcctcatggtcctgcctccccagctgcatctggagccaggcacctacaccctccac
atcctcccaaagcctccgccagtgccctaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107511167
Entry
107511167         CDS       T06036                                 

Gene name
SPDYA
Definition
(RefSeq) speedy protein A isoform X1
  KO
K08694  speedy
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04114  Oocyte meiosis
ray04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107511167 (SPDYA)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107511167 (SPDYA)
SSDB
Motif
Pfam: Spy1
Other DBs
NCBI-GeneID: 107511167
NCBI-ProteinID: XP_016000828
LinkDB
Position
Unknown
AA seq 285 aa
MRHNQLCCETPPTVTVHVKSGSSRSHQPKKTINLKRPIFKDSWPESEKNAHNSNKSKRPK
GPCLVIQRQEMTAFFKLFDDDLIQDFLWMDCCCKIADKYLLAMTFVYFKRAKFTINEHTR
INFFIALYLANTVEEDEEESKYEIFPWALGKNWRKLFPNFLKLRDQLWDRIDYRAIVSRR
CCEEVMAIAPTHYIWQRERSVHHSGAVRNYNRDEVQLPRGPSATPVDCSLCGKKGRYVRL
GLSSSSSSSDTVQAMEKQSQESHNLFSVDIVVDPSQVYNYSQGMI
NT seq 858 nt   +upstreamnt  +downstreamnt
atgaggcataatcagctgtgttgtgagacaccacctactgtcactgttcatgtaaaatca
gggtcaagtagatcacatcagcctaaaaaaaccattaatctgaagcgtccaatttttaaa
gatagttggccagaatctgaaaaaaatgcacataatagcaacaagtctaaacgccccaaa
ggaccctgcctagttatacagcgtcaggaaatgactgctttctttaaattatttgatgac
gatttaattcaagatttcttgtggatggactgctgctgtaagattgcagacaagtatctt
ttggctatgacctttgtttatttcaagagggctaaatttactataaatgagcataccagg
ataaatttctttattgctctgtatctggctaatacagttgaagaagatgaagaagaatcc
aaatatgagatttttccatgggctttagggaaaaactggagaaaattattccctaatttc
ttaaagttaagggaccaactctgggatagaattgactatagggctattgtaagcaggcga
tgctgtgaggaggttatggccattgctccaacccattatatatggcaacgagaacgttct
gtgcatcacagtggagctgttaggaactacaacagagatgaagttcaactgccccgggga
cctagtgccacacctgtagattgctcactctgtggtaaaaaaggaagatatgttagactg
ggattgtcttcatcatcttcatccagtgatacagtacaggcgatggaaaaacagtcccag
gagtcacacaacttattctcagtggacatagtagttgatccttctcaagtttataactat
tcgcaaggtatgatttag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107515932
Entry
107515932         CDS       T06036                                 

Definition
(RefSeq) speedy protein E4-like isoform X1
  KO
K08694  speedy
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04114  Oocyte meiosis
ray04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107515932
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107515932
SSDB
Motif
Pfam: Spy1 pXO2-72
Other DBs
NCBI-GeneID: 107515932
NCBI-ProteinID: XP_016010687
LinkDB
Position
Unknown
AA seq 238 aa
MKQKHLRELMASCRPDILCEDHSSQPSYSGCSLEAKLDKETPGPSDSRLSPQSPGRKGKK
AWSAEEEGTAPEAEDVWVVETLCGLKMKLKRRRVSSVLPEHHEVFRRLLEDPVIKKFLAW
DKNLKVSDKYLLAMVIAYFSRAGLFSWQYQRIHFFLALYLASDMEEDNQAPKQAIFSFLF
GKNRSKRPLFHKLRFQFVRSMGWKTRVSQEECEEIQAFHPELWVWARDRAFIPKTTEA
NT seq 717 nt   +upstreamnt  +downstreamnt
atgaaacagaagcatttgagagagctcatggccagttgtcgacccgatatcctgtgtgag
gaccacagctcccagcctagctactcaggatgctctctggaggcgaagctggataaagaa
accccgggaccatcagattctaggctgtcccctcagtctcctggccggaaggggaagaag
gcgtggtcagcagaggaggaggggaccgcccctgaggctgaggacgtctgggtcgtggag
acactgtgtggcctcaagatgaagttgaagaggcggcgggtgtcttcggtgctccctgag
catcacgaggtcttcaggaggctgctcgaagatcctgtcattaaaaagttcctggcctgg
gacaaaaatctgaaggtatctgacaagtacctcctggctatggtcatagcgtacttcagc
cgagcgggcctcttctcctggcagtaccagcgaatccacttcttcctggccctctacctg
gccagtgacatggaagaggacaaccaggcccctaaacaggccatcttttccttcctcttt
gggaagaaccgctctaagcgtcccttgttccacaaactgcggttccagttcgtccgctcc
atgggttggaagacgagggtctcccaggaagaatgcgaagagatccaggcttttcatcca
gagctctgggtgtgggcgcgagatcgcgccttcattcccaagactacggaggcctga

DBGET integrated database retrieval system