KEGG   Rousettus aegyptiacus (Egyptian rousette): 107497522
Entry
107497522         CDS       T06036                                 

Gene name
RELA
Definition
(RefSeq) transcription factor p65
  KO
K04735  transcription factor p65
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01523  Antifolate resistance
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04024  cAMP signaling pathway
ray04062  Chemokine signaling pathway
ray04064  NF-kappa B signaling pathway
ray04066  HIF-1 signaling pathway
ray04071  Sphingolipid signaling pathway
ray04137  Mitophagy - animal
ray04151  PI3K-Akt signaling pathway
ray04210  Apoptosis
ray04211  Longevity regulating pathway
ray04218  Cellular senescence
ray04380  Osteoclast differentiation
ray04620  Toll-like receptor signaling pathway
ray04621  NOD-like receptor signaling pathway
ray04622  RIG-I-like receptor signaling pathway
ray04623  Cytosolic DNA-sensing pathway
ray04625  C-type lectin receptor signaling pathway
ray04657  IL-17 signaling pathway
ray04658  Th1 and Th2 cell differentiation
ray04659  Th17 cell differentiation
ray04660  T cell receptor signaling pathway
ray04662  B cell receptor signaling pathway
ray04668  TNF signaling pathway
ray04722  Neurotrophin signaling pathway
ray04917  Prolactin signaling pathway
ray04920  Adipocytokine signaling pathway
ray04926  Relaxin signaling pathway
ray04931  Insulin resistance
ray04932  Non-alcoholic fatty liver disease
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray05010  Alzheimer disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05030  Cocaine addiction
ray05132  Salmonella infection
ray05133  Pertussis
ray05134  Legionellosis
ray05135  Yersinia infection
ray05140  Leishmaniasis
ray05142  Chagas disease
ray05145  Toxoplasmosis
ray05146  Amoebiasis
ray05152  Tuberculosis
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05162  Measles
ray05163  Human cytomegalovirus infection
ray05164  Influenza A
ray05165  Human papillomavirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05200  Pathways in cancer
ray05202  Transcriptional misregulation in cancer
ray05203  Viral carcinogenesis
ray05212  Pancreatic cancer
ray05215  Prostate cancer
ray05220  Chronic myeloid leukemia
ray05221  Acute myeloid leukemia
ray05222  Small cell lung cancer
ray05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ray05321  Inflammatory bowel disease
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107497522 (RELA)
   04014 Ras signaling pathway
    107497522 (RELA)
   04064 NF-kappa B signaling pathway
    107497522 (RELA)
   04668 TNF signaling pathway
    107497522 (RELA)
   04066 HIF-1 signaling pathway
    107497522 (RELA)
   04071 Sphingolipid signaling pathway
    107497522 (RELA)
   04024 cAMP signaling pathway
    107497522 (RELA)
   04151 PI3K-Akt signaling pathway
    107497522 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    107497522 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    107497522 (RELA)
   04218 Cellular senescence
    107497522 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107497522 (RELA)
   04621 NOD-like receptor signaling pathway
    107497522 (RELA)
   04622 RIG-I-like receptor signaling pathway
    107497522 (RELA)
   04623 Cytosolic DNA-sensing pathway
    107497522 (RELA)
   04625 C-type lectin receptor signaling pathway
    107497522 (RELA)
   04660 T cell receptor signaling pathway
    107497522 (RELA)
   04658 Th1 and Th2 cell differentiation
    107497522 (RELA)
   04659 Th17 cell differentiation
    107497522 (RELA)
   04657 IL-17 signaling pathway
    107497522 (RELA)
   04662 B cell receptor signaling pathway
    107497522 (RELA)
   04062 Chemokine signaling pathway
    107497522 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    107497522 (RELA)
   04917 Prolactin signaling pathway
    107497522 (RELA)
   04926 Relaxin signaling pathway
    107497522 (RELA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107497522 (RELA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107497522 (RELA)
  09149 Aging
   04211 Longevity regulating pathway
    107497522 (RELA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107497522 (RELA)
   05202 Transcriptional misregulation in cancer
    107497522 (RELA)
   05203 Viral carcinogenesis
    107497522 (RELA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107497522 (RELA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    107497522 (RELA)
   05221 Acute myeloid leukemia
    107497522 (RELA)
   05220 Chronic myeloid leukemia
    107497522 (RELA)
   05215 Prostate cancer
    107497522 (RELA)
   05222 Small cell lung cancer
    107497522 (RELA)
  09163 Immune disease
   05321 Inflammatory bowel disease
    107497522 (RELA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107497522 (RELA)
   05022 Pathways of neurodegeneration - multiple diseases
    107497522 (RELA)
  09165 Substance dependence
   05030 Cocaine addiction
    107497522 (RELA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107497522 (RELA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    107497522 (RELA)
   04931 Insulin resistance
    107497522 (RELA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107497522 (RELA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107497522 (RELA)
   05135 Yersinia infection
    107497522 (RELA)
   05133 Pertussis
    107497522 (RELA)
   05134 Legionellosis
    107497522 (RELA)
   05152 Tuberculosis
    107497522 (RELA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107497522 (RELA)
   05170 Human immunodeficiency virus 1 infection
    107497522 (RELA)
   05162 Measles
    107497522 (RELA)
   05164 Influenza A
    107497522 (RELA)
   05161 Hepatitis B
    107497522 (RELA)
   05160 Hepatitis C
    107497522 (RELA)
   05168 Herpes simplex virus 1 infection
    107497522 (RELA)
   05163 Human cytomegalovirus infection
    107497522 (RELA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107497522 (RELA)
   05169 Epstein-Barr virus infection
    107497522 (RELA)
   05165 Human papillomavirus infection
    107497522 (RELA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107497522 (RELA)
   05145 Toxoplasmosis
    107497522 (RELA)
   05140 Leishmaniasis
    107497522 (RELA)
   05142 Chagas disease
    107497522 (RELA)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    107497522 (RELA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ray03000]
    107497522 (RELA)
Transcription factors [BR:ray03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    107497522 (RELA)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 107497522
NCBI-ProteinID: XP_015974930
LinkDB
Position
Unknown
AA seq 551 aa
MDDLFPLIFPSEPAPASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC
VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLCLSPVLS
HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS
QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTYETFKSIMKKSPFNGPTDPRPPPRRIAVPSRSSTSVPKPAPQSYPFTPSLSTINF
EEFAPVVFSSGQMPGQTPVLASAPAPVLAHVPAPAPAMTSALAQAPAPGQVLTSALAQAV
APPAPKPTQAGEGTLSEALLQLQFDADEDLGSLLGNNTDPAVFSDLASVDNSEFQQLLNQ
GVSLASHTAEPMLMEYPESITRLVTGSQRPPDPAPTSLGASGLPNGLLSGDEDFSSIADM
DFSALLSQISS
NT seq 1656 nt   +upstreamnt  +downstreamnt
atggacgacctgttccccctcatcttcccctctgaaccagccccggcctccggcccctat
gtggaaatcatcgagcagcccaaacagcggggcatgcgcttccgctacaagtgcgagggt
cgctcagcaggcagcatccccggggagcggagcactgacaccaccaagacccaccccacc
atcaagatcaatggctacacgggaccagggacagttcgcatctccttggtcaccaaggac
ccccctcaccggcctcacccccatgagctggtggggaaagactgccgggatggcttctat
gaggccgagctctgcccggaccgctgcatccacagcttccagaacctggggatccagtgt
gtgaagaagcgggacctggaacaggccatcagtcagcgcatccagaccaacaacaacccc
ttccaagttcccatagaagagcagcgtggggactacgacttgaatgccgttcggctctgc
ttccaggtgacagtgcgggatccgtcaggcaggcccctctgcctgtcgcctgtcctctct
catcccatctttgacaaccgcgcccccaacacagcagagctcaagatctgccgagtgaac
cgaaactccgggagctgcctcggtggggatgagattttcctgctgtgtgacaaggtgcag
aaagaggacattgaggtgtacttcacgggaccgggctgggaggcccgaggctccttttcg
caagccgatgtccatcgacaagtggccattgtgttccggacccctccctatgctgacccc
agcttgcaggcccccgtgcgtgtctccatgcagctgcggcggccttcggatcgggagctc
agcgagcccatggaattccagtacttgccagacacagatgaccgtcaccggattgaggag
aaacgcaaaaggacctatgagaccttcaagagcatcatgaaaaagagtcctttcaacggc
cccaccgacccccggcctccaccccggcgcattgccgtgccttcccgcagctccacttct
gtccccaagccagctccccagtcctatccctttacgccatccctcagcaccatcaacttt
gaggagtttgcccctgtggtcttttcctctgggcagatgcccggccagaccccagtcttg
gcatcagcccctgccccagtcctggcccacgtgccagcccctgccccagccatgacatca
gctctggctcaggccccagcccctggccaagttctaacctcagcccttgctcaggctgtg
gccccgcctgctcccaagcccacccaggctggggaaggaacactgtcggaggccctgctg
cagctgcagtttgatgctgatgaagacctggggtccctgctcggcaataacactgaccca
gctgtgttctcggacctggcatctgtcgacaattccgagtttcagcagctgctgaaccag
ggtgtatctctggcctcccatacagcagagcccatgctgatggagtatcctgagtctata
actcgcctggtgacagggtcccagaggccccctgacccagcgcccacttccctgggggcc
tctgggctccccaacggcctcctctcaggagatgaagacttctcctccattgcagatatg
gacttctcagcccttctgagtcagatcagctcctaa

DBGET integrated database retrieval system