KEGG   Rousettus aegyptiacus (Egyptian rousette): 107497635
Entry
107497635         CDS       T06036                                 

Gene name
FFAR1
Definition
(RefSeq) free fatty acid receptor 1
  KO
K04325  free fatty acid receptor 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107497635 (FFAR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ray04030]
    107497635 (FFAR1)
G protein-coupled receptors [BR:ray04030]
 Rhodopsin family
  Lipid
   Free fatty acid
    107497635 (FFAR1)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 107497635
NCBI-ProteinID: XP_015975178
LinkDB
Position
Unknown
AA seq 300 aa
MDLPPQLSFALYVAAFVLGFPLNVLAIWGAVAHARLHLTPSLVYALHLSCSDLLLAASLP
LKAVEALAAGAWPLPALLCPAFALAHFAPLYAGGGFLAALSVGRYLGAAFPLGYQAARRP
CYSWGVCAAIWALVLCHLGLVFGLEAPGGWMDNTTSSLGLNTPVNGSPVCLEAWDPASAG
PARLSLSLLLFFLPLTITAFCYVGCLRALAGSGLSHRRKLRAAWVAGGALLTLLLCLGPY
NASNVAGFLYPDLGGCWRKLGLLTGAWSVVLNPLVTGYLGQGAGRGTSCAARTKGGTSQK
NT seq 903 nt   +upstreamnt  +downstreamnt
atggacctgcccccgcagctctccttcgctctctatgtggccgcctttgtgctgggcttc
ccgctcaacgtcctggccatctggggcgctgtggctcacgcccggctccacctcaccccc
agccttgtctatgcccttcacctaagctgctcggacctcctgctggcagcctccctgccc
ctgaaggcagtggaagccctggctgctggagcctggcctctgccagccctgctctgtcct
gcctttgccctggcccactttgctccactctatgctggcggtggcttcctggccgccctg
agtgtcggccgctacctaggagccgctttccccttggggtaccaagccgcccggaggccc
tgttattcctggggcgtgtgtgcggccatatgggcccttgtcctctgtcacctggggctg
gtctttgggttggaggcaccaggaggctggatggacaataccaccagttccctaggcctc
aacacgccagtcaatggctctccagtctgcctggaggcctgggacccagcctcagcgggc
cctgctcgcctcagcctctctctcctgctcttctttctgcccctgaccatcacggccttc
tgctatgtgggctgcctccgggcgctggctggctcaggcctgagccacagacgaaagcta
agagcagcctgggtggctggtggggctctactcacgctgctgctctgcttgggaccctac
aatgcctccaatgtggccggcttcctgtaccccgacttgggaggctgctggaggaagctg
gggctcctcacaggtgcttggagcgtcgtgctcaacccattggtgactggctacttggga
cagggggctggccgggggacatcatgtgcggcaagaacaaaagggggtacttctcagaag
tag

DBGET integrated database retrieval system