KEGG   Rousettus aegyptiacus (Egyptian rousette): 107497773
Entry
107497773         CDS       T06036                                 

Gene name
CD86
Definition
(RefSeq) T-lymphocyte activation antigen CD86 isoform X1
  KO
K05413  CD86 antigen
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04514  Cell adhesion molecules
ray04620  Toll-like receptor signaling pathway
ray04672  Intestinal immune network for IgA production
ray04940  Type I diabetes mellitus
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05202  Transcriptional misregulation in cancer
ray05320  Autoimmune thyroid disease
ray05322  Systemic lupus erythematosus
ray05323  Rheumatoid arthritis
ray05330  Allograft rejection
ray05332  Graft-versus-host disease
ray05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107497773 (CD86)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107497773 (CD86)
   04672 Intestinal immune network for IgA production
    107497773 (CD86)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    107497773 (CD86)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    107497773 (CD86)
   05323 Rheumatoid arthritis
    107497773 (CD86)
   05320 Autoimmune thyroid disease
    107497773 (CD86)
   05330 Allograft rejection
    107497773 (CD86)
   05332 Graft-versus-host disease
    107497773 (CD86)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107497773 (CD86)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107497773 (CD86)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    107497773 (CD86)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107497773 (CD86)
   04090 CD molecules [BR:ray04090]
    107497773 (CD86)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107497773 (CD86)
CD molecules [BR:ray04090]
 Proteins
  107497773 (CD86)
SSDB
Motif
Pfam: V-set Ig_3 Ig_2 I-set C2-set_2 Ig_6
Other DBs
NCBI-GeneID: 107497773
NCBI-ProteinID: XP_015975484
LinkDB
Position
Unknown
AA seq 352 aa
MAKMDHRCTMELSKTLFVIALLLSGAASMKSQAYFNETGDLPCHFTNSQNISLDELVVFW
QNQDKLVLYELFKGKENPQNVHPKYKGRASFDQDNWALRLHNVQIKDTGTYQCFIHRKRP
QGLVSIHQMSSDLSVLANFSQPEIMIISNRTENSDTINLTCSSIQGYPKPKKMSFVRKTE
NSTTEDDVVMNIFQNNFTDLYNVSISLSISVSPKRNVSIFCVLQPGSTQTQLVSQPYNID
AKPPMLPPPAPDRVLTVALLLLFIFVCGVVFLILMKMKRKQPGPSRECEANNMEERESEQ
GKERVENRASERFDKVQCDVNTSTTASDSVAVMRSKETSSSFREEEKHKHNR
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggccaagatggatcacagatgcactatggaactgagcaaaactctctttgtgatagct
ctcctgctctctggtgctgcttccatgaaaagtcaggcatatttcaatgagactggagac
cttccatgccactttacaaactctcaaaacataagccttgatgagctggtagtattttgg
cagaaccaggataagctggttctgtacgagctattcaaaggcaaagagaaccctcaaaat
gttcaccccaagtataagggccgcgcaagcttcgaccaggacaactgggccctgcgactc
cacaatgttcagatcaaggacacgggcacgtatcagtgtttcatccaccgcaaaaggccc
caaggacttgtttccatccaccaaatgagttctgacctgtcagtgcttgctaacttcagt
caacctgaaataatgataatttctaatagaacagaaaattctgacaccataaatttgacc
tgctcatctatacaaggttacccgaaacctaagaagatgtcttttgtgcgaaaaactgag
aattcaactaccgaggacgatgttgtcatgaatatatttcaaaataatttcacagacctg
tacaacgtttctatcagcttgtctatttcagtgtctcctaaaagaaatgtgagcatcttc
tgtgtcctgcagcctgggtcaacacagacacagcttgtctctcaaccttacaatatagat
gcaaagccacctatgctaccaccgcctgccccagaccgtgtcctgactgtggccttactt
ctactgtttatctttgtgtgtggggtggtctttctaatactaatgaaaatgaagaggaag
cagcctggcccctctcgtgaatgtgaagccaacaacatggaggagagagagagtgaacag
ggcaaagaaagagtagaaaatcgtgcatctgaaagatttgacaaagtccagtgtgatgtt
aacacttcgacgacagcctcagattcggttgcagtgatgagatctaaagagacttccagc
agcttcagggaggaggagaaacacaagcacaaccgatga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107508366
Entry
107508366         CDS       T06036                                 

Gene name
CD80
Definition
(RefSeq) T-lymphocyte activation antigen CD80
  KO
K05412  CD80 antigen
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04514  Cell adhesion molecules
ray04620  Toll-like receptor signaling pathway
ray04672  Intestinal immune network for IgA production
ray04940  Type I diabetes mellitus
ray05320  Autoimmune thyroid disease
ray05322  Systemic lupus erythematosus
ray05323  Rheumatoid arthritis
ray05330  Allograft rejection
ray05332  Graft-versus-host disease
ray05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107508366 (CD80)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107508366 (CD80)
   04672 Intestinal immune network for IgA production
    107508366 (CD80)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    107508366 (CD80)
   05323 Rheumatoid arthritis
    107508366 (CD80)
   05320 Autoimmune thyroid disease
    107508366 (CD80)
   05330 Allograft rejection
    107508366 (CD80)
   05332 Graft-versus-host disease
    107508366 (CD80)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107508366 (CD80)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107508366 (CD80)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ray04090]
    107508366 (CD80)
CD molecules [BR:ray04090]
 Proteins
  107508366 (CD80)
SSDB
Motif
Pfam: C2-set_2 V-set Ig_3 Ig_2 ig I-set Ig_6 Receptor_2B4
Other DBs
NCBI-GeneID: 107508366
NCBI-ProteinID: XP_015995623
LinkDB
Position
Unknown
AA seq 275 aa
MDHTLKWGTPSSKFSYFKLFKLLALAGLFNFCFCSGISQVTKTVKDVAVLSCGYNISTDE
LTRVRVYWQKYHEMVLAVINGKVQVWPKYENRTFTDISKNLSIVILALRLSDSGMYTCVI
QKTEKGSYKREHLISVMLFVRADFLVPNITDLGNPSTNIKRIICSTSGGFPKPQLSWWEN
GRELDAINTTVSQDPETELYTISSKLDFDVTNNHSFICLVTYGNLTVSQTFNWRKSEPPS
PSSYLIWLWFLLPLSIGAIIIITLLFNRFTARRNN
NT seq 828 nt   +upstreamnt  +downstreamnt
atggatcatacattaaagtggggaacaccatcatccaaattctcatacttcaagctcttc
aagctattggcgctggctggtctttttaacttctgtttctgttcaggcatcagccaggtg
accaagacagtgaaagatgtagcagtactatcctgtggttacaacatttccactgatgaa
ctgacaagagttcgtgtctactggcaaaaatatcatgaaatggtgctggctgttataaat
ggaaaagtgcaagtgtggcccaagtatgagaaccgtaccttcactgacatctccaaaaac
ctctccattgtgatcctggctctacgcctgtcggacagtggcatgtacacctgtgtcatt
cagaagactgaaaaagggtcttacaaacgggaacacttgatttcggtgatgttatttgtc
agagctgacttccttgtccctaatataactgaccttggaaatccatctactaacatcaaa
aggataatttgctcaacctccggaggttttccaaagcctcagctctcctggtgggaaaat
ggaagagagttagatgccatcaacacaacagtttcccaagatcctgagactgagctctat
actattagcagtaaactggatttcgatgtgacaaacaaccacagcttcatatgtcttgtc
acatatggaaacttaacagtgtctcagaccttcaactggcgaaaatctgagccaccctct
ccatcttcttatttaatctggctatggttccttttaccattgagcatcggagcaataata
atcataacactcctattcaacaggtttactgcaagacggaacaactga

DBGET integrated database retrieval system