KEGG   Rousettus aegyptiacus (Egyptian rousette): 107497788
Entry
107497788         CDS       T06036                                 

Gene name
BTRC
Definition
(RefSeq) F-box/WD repeat-containing protein 1A isoform X1
  KO
K03362  F-box and WD-40 domain protein 1/11
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04114  Oocyte meiosis
ray04120  Ubiquitin mediated proteolysis
ray04218  Cellular senescence
ray04310  Wnt signaling pathway
ray04340  Hedgehog signaling pathway
ray04390  Hippo signaling pathway
ray04710  Circadian rhythm
ray05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107497788 (BTRC)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107497788 (BTRC)
   04340 Hedgehog signaling pathway
    107497788 (BTRC)
   04390 Hippo signaling pathway
    107497788 (BTRC)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107497788 (BTRC)
   04218 Cellular senescence
    107497788 (BTRC)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    107497788 (BTRC)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107497788 (BTRC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ray04121]
    107497788 (BTRC)
   03036 Chromosome and associated proteins [BR:ray03036]
    107497788 (BTRC)
Ubiquitin system [BR:ray04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     107497788 (BTRC)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     107497788 (BTRC)
SSDB
Motif
Pfam: WD40 Beta-TrCP_D F-box-like ANAPC4_WD40 F-box Nup160 WD40_like F-box_5 PAN_3 DUF4508 WD40_2
Other DBs
NCBI-GeneID: 107497788
NCBI-ProteinID: XP_015975522
LinkDB
Position
Unknown
AA seq 605 aa
MDPAEAVLQEKALKFMCSMPRSLWLGCSSLADSMPSLRCLYNPGTGALTAFQNSSEREDC
NNGEPPRKIIPEKNSLRQTYNSCARLCLNQETVCLASTAMKTENCVAKTKLANGTSSMIV
PKQRKLSASYEKEKELCVKYFEQWSESDQVEFVEHLISQMCHYQHGHINSYLKPMLQRDF
ITALPARGLDHIAENILSYLDAKSLCAAELVCKEWYRVTSDGMLWKKLIERMVRTDSLWR
GLAERRGWGQYLFKNKPPDGNAPPNSFYRALYPKIIQDIETIESNWRCGRHSLQRIHCRS
ETSKGVYCLQYDDQKIVSGLRDNTIKIWDKSTLECKRILTGHTGSVLCLQYDERVIITGS
SDSTVRVWDVNTGEMLNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRR
VLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVV
SGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLVAALDPR
APAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLNDPAAQAEPPRSPSRTY
TYISR
NT seq 1818 nt   +upstreamnt  +downstreamnt
atggacccggccgaggcggtgctgcaggaaaaagcgctcaagtttatgtgctctatgccc
aggtctctgtggctgggctgctccagcctggcggacagcatgccttcgctgcggtgcctg
tataacccagggactggcgcactcacagctttccagaattcctcagagagagaagactgt
aataatggcgaaccccctaggaagataataccagagaagaattcacttagacagacttac
aacagctgtgccagactctgcttaaaccaagaaacagtatgtctagcaagcactgctatg
aagactgaaaattgtgtggccaaaacaaaacttgccaatggcacttccagtatgattgtg
cccaagcaacggaaactctcggcaagctatgagaaggaaaaggaactgtgtgtcaaatat
tttgagcagtggtcagagtccgatcaagtggaatttgtggaacatcttatatctcaaatg
tgtcattatcagcatgggcacataaactcgtatcttaaacctatgttgcagagggatttc
ataacagctctgccagctcggggtttagatcacattgctgagaacattctctcatacctg
gatgccaaatcactatgtgctgctgaactggtgtgcaaagaatggtaccgagtgacatct
gatggcatgttatggaaaaagctcattgagagaatggtcaggacagattctctgtggaga
ggcctggcagaacgaagagggtggggacagtatttattcaaaaacaaacctcctgatggg
aacgctcctcccaactctttttatagagcactttatcctaaaattatacaagacattgag
actatagaatctaattggagatgtggaagacatagtttacagagaattcactgtcgaagt
gaaacaagcaaaggtgtttactgtttacagtatgatgatcagaagatagtaagcggcctt
cgagacaacacgattaagatctgggataaaagcacattggaatgcaagcgaattctcaca
ggccacacgggttctgtcctatgtcttcagtatgatgagagggtgatcataactggatca
tcggattccacggtcagagtgtgggatgtaaatacaggtgaaatgctaaatacgttgatt
caccattgtgaagcagttttgcacttgcgtttcaataacggcatgatggtgacctgctcc
aaagaccgttccattgctgtatgggatatggcctccccaactgacatcaccctccggagg
gtgcttgtcggacaccgcgcagccgtcaatgttgtagactttgatgacaagtacattgtt
tctgcatctggagataggactataaaggtatggaacacaagtacttgtgaatttgtaagg
accttaaatggacacaaacgtggcatcgcctgtttgcagtacagagacaggctggttgtg
agtggctcgtctgacaacactatcagattatgggacatagaatgtggtgcatgtttacga
gtattagaaggccatgaggaattggtgcgctgtattcgatttgataacaagaggatagtc
agtggagcctatgatggaaaaattaaagtatgggatcttgtagctgctttggatccccga
gctcctgcagggactctctgtctgcggacccttgtggagcattctggaagagtcttccga
ctccagtttgacgaattccagattgtcagtagttcacatgacgacacaatcctcatctgg
gactttctaaatgatccagctgcccaagctgaacccccccgttccccttctcgaacatac
acctatatctccagataa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107511023
Entry
107511023         CDS       T06036                                 

Gene name
FBXW11
Definition
(RefSeq) F-box/WD repeat-containing protein 11 isoform X1
  KO
K03362  F-box and WD-40 domain protein 1/11
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04114  Oocyte meiosis
ray04120  Ubiquitin mediated proteolysis
ray04218  Cellular senescence
ray04310  Wnt signaling pathway
ray04340  Hedgehog signaling pathway
ray04390  Hippo signaling pathway
ray04710  Circadian rhythm
ray05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107511023 (FBXW11)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107511023 (FBXW11)
   04340 Hedgehog signaling pathway
    107511023 (FBXW11)
   04390 Hippo signaling pathway
    107511023 (FBXW11)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107511023 (FBXW11)
   04218 Cellular senescence
    107511023 (FBXW11)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    107511023 (FBXW11)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107511023 (FBXW11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ray04121]
    107511023 (FBXW11)
   03036 Chromosome and associated proteins [BR:ray03036]
    107511023 (FBXW11)
Ubiquitin system [BR:ray04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     107511023 (FBXW11)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     107511023 (FBXW11)
SSDB
Motif
Pfam: WD40 Beta-TrCP_D ANAPC4_WD40 F-box-like F-box WD40_like Nup160 DUF1513 WD40_2 DUF4508
Other DBs
NCBI-GeneID: 107511023
NCBI-ProteinID: XP_016000575
LinkDB
Position
Unknown
AA seq 563 aa
MEPDSVIEDKTIELMCSVPRSLWLGCANLVESMCALSCLQSMPSVRCLQNTSVMEDHNED
ESPKKSTLWQISNGTSSVIVSRKRPSEGNYQKEKDLCIKYFDQWSESDQVEFVEHLISRM
CHYQHGHINSYLKPMLQRDFITALPEQGLDHIAENILSYLDARSLCAAELVCKEWQRVIS
EGMLWKKLIERMVRTDPLWKGLSERRGWDQYLFKNRPTDGPPNSFYRSLYPKIIQDIETI
ESNWRCGRHNLQRIQCRSENSKGVYCLQYDDEKIISGLRDNSIKIWDKTSLECLKVLTGH
TGSVLCLQYDERVIVTGSSDSTVRVWDVNTGEVLNTLIHHNEAVLHLRFSNGLMVTCSKD
RSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTL
NGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSG
AYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDF
LNVPPSAQNETRSPSRTYTYISR
NT seq 1692 nt   +upstreamnt  +downstreamnt
atggagcccgactcggtgattgaggacaagaccatcgagctcatgtgttctgtgcccagg
tctttgtggctaggctgcgccaacctggtagagagcatgtgcgcactgagttgcctgcag
agcatgcccagtgtcagatgtctccagaacacttcagttatggaggatcacaatgaagat
gagtccccaaagaaaagtactctttggcagataagtaatggaacatcatccgtgatcgtc
tccagaaagaggccgtcagaaggaaactatcaaaaagaaaaagacttgtgtattaaatat
tttgaccagtggtctgaatcggatcaggtggagttcgtggagcaccttatttcccgaatg
tgtcattaccagcatggacatatcaactcgtacctgaagcccatgttgcagcgggacttc
atcaccgcgctaccagagcaaggcctagatcacatagcagaaaacattctttcctacctg
gacgccaggtctctgtgtgccgcagagctggtgtgtaaagaatggcagcgcgtgatctcg
gaaggaatgctttggaagaagctgatcgagcgaatggtgcgcactgaccccctgtggaag
ggactttcagaaagaagagggtgggatcagtacctgtttaaaaacagacccacagatggc
cctcccaattcattttataggtcactgtacccaaagattatccaggatatagagactata
gaatctaactggcggtgtggacgacacaacttgcagaggattcagtgccgctctgaaaat
agtaaaggtgtctactgtttacagtacgatgatgaaaaaattatcagtggcctgcgagat
aattctattaagatttgggataaaaccagcttggaatgtttgaaagtgttaacggggcac
actggctctgtcctttgtctccagtatgatgaacgtgtcattgtgacgggctcatcagac
tcgacagtgagggtctgggacgtgaacacgggcgaagttctgaacacgctgatccaccac
aacgaggccgtgctgcacttgcgcttcagcaacgggctgatggtgacctgctccaaggac
cgctccatcgccgtgtgggacatggcttccgccaccgatatcactctgcgccgcgtcttg
gtcggccaccgtgccgctgtcaatgtggtagacttcgatgataagtacattgtgtctgcc
tctggtgacagaaccatcaaagtctggagcacgagcacctgtgaatttgtccgcacgctg
aacgggcacaagcgaggcatcgcctgtctccagtacagggaccggctggtcgttagtggg
tcctcagataataccatcaggctgtgggatatcgaatgcggcgcctgtttaagagttcta
gaggggcatgaagagttggtccggtgcatccggtttgacaacaagaggattgtcagcggg
gcctatgacgggaaaattaaagtttgggacttgcaagctgccctcgaccctcgcgcccca
gccagcacactgtgtttgcgcacgttggtggaacattctggacgcgtgttccggctacag
tttgatgaatttcagatcatcagcagctctcacgatgacactattttgatttgggatttc
ttaaatgtgcctcccagcgcccagaacgagacccgctctccctccaggacatacacttac
atctccagataa

DBGET integrated database retrieval system