KEGG   Rousettus aegyptiacus (Egyptian rousette): 107497819
Entry
107497819         CDS       T06036                                 

Gene name
RAB5A
Definition
(RefSeq) ras-related protein Rab-5A
  KO
K07887  Ras-related protein Rab-5A
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04014  Ras signaling pathway
ray04144  Endocytosis
ray04145  Phagosome
ray04962  Vasopressin-regulated water reabsorption
ray05014  Amyotrophic lateral sclerosis
ray05022  Pathways of neurodegeneration - multiple diseases
ray05132  Salmonella infection
ray05146  Amoebiasis
ray05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107497819 (RAB5A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107497819 (RAB5A)
   04145 Phagosome
    107497819 (RAB5A)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107497819 (RAB5A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    107497819 (RAB5A)
   05022 Pathways of neurodegeneration - multiple diseases
    107497819 (RAB5A)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107497819 (RAB5A)
   05152 Tuberculosis
    107497819 (RAB5A)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107497819 (RAB5A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107497819 (RAB5A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107497819 (RAB5A)
   04031 GTP-binding proteins [BR:ray04031]
    107497819 (RAB5A)
Membrane trafficking [BR:ray04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab GTPases
    107497819 (RAB5A)
 Endosome - Lysosome transport
    107497819 (RAB5A)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107497819 (RAB5A)
  Exosomal proteins of other body fluids (saliva and urine)
   107497819 (RAB5A)
  Exosomal proteins of colorectal cancer cells
   107497819 (RAB5A)
  Exosomal proteins of bladder cancer cells
   107497819 (RAB5A)
GTP-binding proteins [BR:ray04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab5/17/22/31 [OT]
    107497819 (RAB5A)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA RsgA_GTPase GTP_EFTU AAA_16 MCR_beta BrnT_toxin
Other DBs
NCBI-GeneID: 107497819
NCBI-ProteinID: XP_015975595
LinkDB
Position
Unknown
AA seq 215 aa
MANRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQ
TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQR
QASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKK
LPKNEPQNPGANSARGRGVDLTEPTQPTRSQCCSN
NT seq 648 nt   +upstreamnt  +downstreamnt
atggctaatcgaggagcaacaagacccaatgggccaaatactggaaataaaatatgccag
ttcaaactagtacttctgggagaatctgctgttggcaaatcaagcctagtgcttcgtttt
gtgaaaggccagtttcatgaatttcaagagagtaccatcggggctgcttttctaacccaa
actgtatgtcttgatgacacaacagtaaagtttgaaatatgggatacagctggtcaagaa
cgataccatagcctagcaccaatgtactacagaggagcacaagcagccatagttgtatat
gatatcacaaatgaggagtcctttgccagagccaaaaattgggttaaagaacttcaaagg
caagccagtcctaacattgtaatagctttatcaggaaacaaggccgaccttgcaaataaa
agagctgttgatttccaggaagcacagtcctatgcagatgacaacagtttattattcatg
gagacgtcagctaaaacatcaatgaatgtaaatgaaatattcatggcaatagctaaaaag
ttgccaaagaatgaaccacagaatccaggagcaaattctgccaggggaagaggagtagac
cttactgaacccacgcagccaactaggagtcagtgttgtagtaactaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513817
Entry
107513817         CDS       T06036                                 

Gene name
RAB5C
Definition
(RefSeq) ras-related protein Rab-5C
  KO
K07889  Ras-related protein Rab-5C
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04014  Ras signaling pathway
ray04144  Endocytosis
ray04145  Phagosome
ray04962  Vasopressin-regulated water reabsorption
ray05132  Salmonella infection
ray05146  Amoebiasis
ray05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107513817 (RAB5C)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107513817 (RAB5C)
   04145 Phagosome
    107513817 (RAB5C)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107513817 (RAB5C)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107513817 (RAB5C)
   05152 Tuberculosis
    107513817 (RAB5C)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107513817 (RAB5C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107513817 (RAB5C)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107513817 (RAB5C)
   04031 GTP-binding proteins [BR:ray04031]
    107513817 (RAB5C)
Membrane trafficking [BR:ray04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab GTPases
    107513817 (RAB5C)
 Endosome - Lysosome transport
    107513817 (RAB5C)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107513817 (RAB5C)
  Exosomal proteins of other body fluids (saliva and urine)
   107513817 (RAB5C)
  Exosomal proteins of colorectal cancer cells
   107513817 (RAB5C)
  Exosomal proteins of bladder cancer cells
   107513817 (RAB5C)
GTP-binding proteins [BR:ray04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab5/17/22/31 [OT]
    107513817 (RAB5C)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA RsgA_GTPase GTP_EFTU AAA_16
Other DBs
NCBI-GeneID: 107513817
NCBI-ProteinID: XP_016006344
LinkDB
Position
Unknown
AA seq 216 aa
MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLT
QTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQ
RQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAK
KLPKNEPQNAAGAPGRNRGVDLQENNPASRSQCCSN
NT seq 651 nt   +upstreamnt  +downstreamnt
atggcgggtcggggaggtgcagcgcgacccaacggaccagctgctgggaacaagatctgt
cagtttaagctggtcctactgggggagtctgcagtgggcaaatccagcctcgtcctccgc
tttgtcaagggacaattccatgagtaccaggagagcacaattggagcggccttcctcaca
cagacggtctgcttggacgacacaacagtcaagtttgagatctgggacacagctggacag
gagcggtatcacagcctggcccccatgtactaccggggggcccaagctgccatcgtggtc
tatgacatcaccaacacagatacgtttgcacgggccaagaactgggtgaaggagttacag
aggcaggccagccccaacatcgtcatcgcactcgcgggtaacaaggcggacctggccagc
aagagagccgtggaattccaggaagcacaagcctatgcagatgacaacagtttactgttc
atggaaacatcagcaaagactgcaatgaacgtgaatgaaattttcatggcaatagctaag
aagctccccaagaatgagccccagaatgcagctggtgctccaggccggaaccgaggtgtg
gacctccaggagaacaacccagccagccggagccagtgctgcagcaactga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107521267
Entry
107521267         CDS       T06036                                 

Gene name
RAB5B
Definition
(RefSeq) ras-related protein Rab-5B
  KO
K07888  Ras-related protein Rab-5B
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04014  Ras signaling pathway
ray04144  Endocytosis
ray04145  Phagosome
ray04962  Vasopressin-regulated water reabsorption
ray05132  Salmonella infection
ray05146  Amoebiasis
ray05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107521267 (RAB5B)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107521267 (RAB5B)
   04145 Phagosome
    107521267 (RAB5B)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107521267 (RAB5B)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107521267 (RAB5B)
   05152 Tuberculosis
    107521267 (RAB5B)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107521267 (RAB5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107521267 (RAB5B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107521267 (RAB5B)
   04031 GTP-binding proteins [BR:ray04031]
    107521267 (RAB5B)
Membrane trafficking [BR:ray04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab GTPases
    107521267 (RAB5B)
 Endosome - Lysosome transport
    107521267 (RAB5B)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107521267 (RAB5B)
  Exosomal proteins of other body fluids (saliva and urine)
   107521267 (RAB5B)
  Exosomal proteins of colorectal cancer cells
   107521267 (RAB5B)
  Exosomal proteins of melanoma cells
   107521267 (RAB5B)
GTP-binding proteins [BR:ray04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab5/17/22/31 [OT]
    107521267 (RAB5B)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA GTP_EFTU RsgA_GTPase AAA_16
Other DBs
NCBI-GeneID: 107521267
NCBI-ProteinID: XP_016021296
LinkDB
Position
Unknown
AA seq 215 aa
MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQ
SVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQR
QASPSIVIALAGNKADLANKRVVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKK
LPKSEPQNLGGAAGRSRGVDLHEQSQQNKSQCCSN
NT seq 648 nt   +upstreamnt  +downstreamnt
atgaccagcagaagcacagcccggcccaatgggcagccccaggccagcaaaatatgccag
ttcaaattggtcctgctgggtgaatctgcagtaggaaagtctagcctggtattacgtttt
gtcaaagggcagttccatgagtaccaggagagtaccattggagcggccttcctcacccag
tctgtttgcctagatgacacaacagtcaagtttgagatctgggacacagctgggcaggag
cgataccatagcttggcccccatgtactacagaggtgcccaagctgcaattgtggtttat
gacattactaatcaggaaaccttcgcccgagcgaagacatgggtaaaggaactacagcga
caggccagtcctagcatcgttattgccctggcagggaacaaagctgatctggccaacaag
cgtgtggtggagtatgaagaggcacaggcatatgcagatgacaacagcttattgtttatg
gagacctcagccaagacagctatgaacgtgaatgatctcttcctggcaatagctaagaag
ttgccaaagagtgaaccccagaatctgggcggtgcagcaggccgaagccgaggtgtggat
ctccatgagcagtcccagcagaacaagagccagtgttgcagcaactga

DBGET integrated database retrieval system