KEGG   Rousettus aegyptiacus (Egyptian rousette): 107497822
Entry
107497822         CDS       T06036                                 

Gene name
SGO1
Definition
(RefSeq) shugoshin-like 1
  KO
K11580  shugoshin-like 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04114  Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107497822 (SGO1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ray03036]
    107497822 (SGO1)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    Shugoshin
     107497822 (SGO1)
SSDB
Motif
Pfam: Shugoshin_N Shugoshin_C
Other DBs
NCBI-GeneID: 107497822
NCBI-ProteinID: XP_015975597
LinkDB
Position
Unknown
AA seq 532 aa
MAKERILKKSFQDSLEDIKKRMKEKRNKNLAEIGKRKSLIAAPCQIITSTSTLLKNYQDN
NKMLVLALENEKSKVREAHDIILQLRKECYYLTCQLYALKEKLTSQQTEELAQNYEVCPS
GMDSNSDKNSGDLFVKDLPQIPLQEGHFPGQGESFQTEEQTSTVPQDRLGFDLNSGEDKS
ADNVLPRTVSLRRNLKKRYNNLCQFNTLDNFEISHVSEQSFELETIGVVDPVVNMHLSEN
AEQNFCQWNKYQINLSPKLIHPGISTKTKEDILDYKSEQTKHKHRDAQGRKREQKRKTNR
RGKSKSVSKYKWSKSKNTKTISEKKLDDFVTSSDAYNFNSEERVHLTPFRQKISNGSKIE
ENSNESEASICESSGSGDDSDDLYLPTCKFSQDLISKSDRSPVTRPRSKRALKCRDEKEM
ESSQPTKTPTSALPEIHRSPHFSLKDITNVPLDPEVKIRKLSLSPKKNKEIPVVSLPKRR
CTTSVNYKEPTLASKLRRGDPFTDLCFLNSPVFKQKKDSRRSSKKKSMKQIQ
NT seq 1599 nt   +upstreamnt  +downstreamnt
atggccaaagaaaggatcctcaaaaagtcctttcaggatagccttgaagacataaagaaa
cggatgaaagagaaaaggaataaaaatttggcagagattggcaaacgaaagtctttaata
gctgcaccatgccaaataatcaccagtacttctacactgctaaaaaactaccaagacaac
aacaaaatgttagttttagctttggaaaatgaaaaatccaaagtgagagaagcccatgac
atcatcctacagctgagaaaggaatgttactacctgacatgtcagttatatgcactgaaa
gaaaaacttacttcacagcaaacagaagaacttgctcagaactatgaagtatgtccctct
ggaatggactccaatagtgacaagaactctggggatttatttgtgaaggatttaccgcaa
attcctctgcaggaaggtcactttccaggacaaggagaatcattccaaacagaagagcaa
acatctactgttcctcaagacagacttgggtttgatttgaattcaggtgaagataagtct
gctgataatgtcttacctagaactgtatctcttcgtcgcaatttaaagaaacggtataac
aatctatgccaattcaatactttggataattttgaaatcagtcatgtgtcagagcagtct
tttgaattggaaaccattggagttgtagacccagtagtaaatatgcatctatctgaaaat
gcagaacaaaacttttgtcagtggaacaagtatcagattaacttatcaccaaaactgatt
cacccaggaatatctactaaaacaaaagaagacattttagactataaatctgaacaaact
aaacataagcacagagatgcacaaggaagaaaaagagaacaaaaaagaaaaactaacaga
aggggaaaatcaaaatctgtatctaagtataaatggagcaaaagtaaaaatacaaaaacc
atttcggaaaaaaagttggatgattttgtcacttccagtgatgcttacaattttaattca
gaagagcgtgttcacctcactccttttcgacaaaaaattagcaatggttctaaaatagaa
gaaaacagcaatgaatccgaagcaagcatctgtgaatcaagtggctcaggagatgattct
gatgacctctatttgcctacttgcaagttcagtcaggatctcatcagcaaatcagatagg
agcccagttaccaggcctcgatctaaaagagcactaaaatgtagagatgaaaaagagatg
gagagttctcagccaacaaaaactcctaccagtgcactacctgaaattcaccggtcacct
cattttagcctgaaggatatcaccaatgtccccttggatcctgaagtgaaaatcagaaaa
ctttctctttctccaaaaaagaataaagaaatcccggtagtgtctctgcctaagcgtagg
tgcacaaccagtgtgaactataaggaacccacactggcttcgaaactgagaagaggggac
ccttttacagatttgtgtttcttgaattcgcctgttttcaagcagaaaaaggattccaga
cgcagttctaaaaaaaaaagtatgaagcaaatacaatga

DBGET integrated database retrieval system