KEGG   Rousettus aegyptiacus (Egyptian rousette): 107497830
Entry
107497830         CDS       T06036                                 

Gene name
MAPK1
Definition
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray01522  Endocrine resistance
ray01524  Platinum drug resistance
ray04010  MAPK signaling pathway
ray04012  ErbB signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04024  cAMP signaling pathway
ray04062  Chemokine signaling pathway
ray04066  HIF-1 signaling pathway
ray04068  FoxO signaling pathway
ray04071  Sphingolipid signaling pathway
ray04072  Phospholipase D signaling pathway
ray04114  Oocyte meiosis
ray04140  Autophagy - animal
ray04150  mTOR signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04210  Apoptosis
ray04218  Cellular senescence
ray04261  Adrenergic signaling in cardiomyocytes
ray04270  Vascular smooth muscle contraction
ray04350  TGF-beta signaling pathway
ray04360  Axon guidance
ray04370  VEGF signaling pathway
ray04371  Apelin signaling pathway
ray04380  Osteoclast differentiation
ray04510  Focal adhesion
ray04520  Adherens junction
ray04540  Gap junction
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04611  Platelet activation
ray04613  Neutrophil extracellular trap formation
ray04620  Toll-like receptor signaling pathway
ray04621  NOD-like receptor signaling pathway
ray04625  C-type lectin receptor signaling pathway
ray04650  Natural killer cell mediated cytotoxicity
ray04657  IL-17 signaling pathway
ray04658  Th1 and Th2 cell differentiation
ray04659  Th17 cell differentiation
ray04660  T cell receptor signaling pathway
ray04662  B cell receptor signaling pathway
ray04664  Fc epsilon RI signaling pathway
ray04666  Fc gamma R-mediated phagocytosis
ray04668  TNF signaling pathway
ray04713  Circadian entrainment
ray04720  Long-term potentiation
ray04722  Neurotrophin signaling pathway
ray04723  Retrograde endocannabinoid signaling
ray04724  Glutamatergic synapse
ray04725  Cholinergic synapse
ray04726  Serotonergic synapse
ray04730  Long-term depression
ray04810  Regulation of actin cytoskeleton
ray04910  Insulin signaling pathway
ray04912  GnRH signaling pathway
ray04914  Progesterone-mediated oocyte maturation
ray04915  Estrogen signaling pathway
ray04916  Melanogenesis
ray04917  Prolactin signaling pathway
ray04919  Thyroid hormone signaling pathway
ray04921  Oxytocin signaling pathway
ray04926  Relaxin signaling pathway
ray04928  Parathyroid hormone synthesis, secretion and action
ray04929  GnRH secretion
ray04930  Type II diabetes mellitus
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray04934  Cushing syndrome
ray04935  Growth hormone synthesis, secretion and action
ray04960  Aldosterone-regulated sodium reabsorption
ray05010  Alzheimer disease
ray05020  Prion disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05034  Alcoholism
ray05132  Salmonella infection
ray05133  Pertussis
ray05135  Yersinia infection
ray05140  Leishmaniasis
ray05142  Chagas disease
ray05145  Toxoplasmosis
ray05152  Tuberculosis
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05163  Human cytomegalovirus infection
ray05164  Influenza A
ray05165  Human papillomavirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05170  Human immunodeficiency virus 1 infection
ray05171  Coronavirus disease - COVID-19
ray05200  Pathways in cancer
ray05203  Viral carcinogenesis
ray05205  Proteoglycans in cancer
ray05206  MicroRNAs in cancer
ray05210  Colorectal cancer
ray05211  Renal cell carcinoma
ray05212  Pancreatic cancer
ray05213  Endometrial cancer
ray05214  Glioma
ray05215  Prostate cancer
ray05216  Thyroid cancer
ray05218  Melanoma
ray05219  Bladder cancer
ray05220  Chronic myeloid leukemia
ray05221  Acute myeloid leukemia
ray05223  Non-small cell lung cancer
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
ray05230  Central carbon metabolism in cancer
ray05231  Choline metabolism in cancer
ray05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107497830 (MAPK1)
   04012 ErbB signaling pathway
    107497830 (MAPK1)
   04014 Ras signaling pathway
    107497830 (MAPK1)
   04015 Rap1 signaling pathway
    107497830 (MAPK1)
   04350 TGF-beta signaling pathway
    107497830 (MAPK1)
   04370 VEGF signaling pathway
    107497830 (MAPK1)
   04371 Apelin signaling pathway
    107497830 (MAPK1)
   04668 TNF signaling pathway
    107497830 (MAPK1)
   04066 HIF-1 signaling pathway
    107497830 (MAPK1)
   04068 FoxO signaling pathway
    107497830 (MAPK1)
   04072 Phospholipase D signaling pathway
    107497830 (MAPK1)
   04071 Sphingolipid signaling pathway
    107497830 (MAPK1)
   04024 cAMP signaling pathway
    107497830 (MAPK1)
   04022 cGMP-PKG signaling pathway
    107497830 (MAPK1)
   04151 PI3K-Akt signaling pathway
    107497830 (MAPK1)
   04150 mTOR signaling pathway
    107497830 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107497830 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    107497830 (MAPK1)
   04210 Apoptosis
    107497830 (MAPK1)
   04218 Cellular senescence
    107497830 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107497830 (MAPK1)
   04520 Adherens junction
    107497830 (MAPK1)
   04540 Gap junction
    107497830 (MAPK1)
   04550 Signaling pathways regulating pluripotency of stem cells
    107497830 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107497830 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107497830 (MAPK1)
   04613 Neutrophil extracellular trap formation
    107497830 (MAPK1)
   04620 Toll-like receptor signaling pathway
    107497830 (MAPK1)
   04621 NOD-like receptor signaling pathway
    107497830 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    107497830 (MAPK1)
   04650 Natural killer cell mediated cytotoxicity
    107497830 (MAPK1)
   04660 T cell receptor signaling pathway
    107497830 (MAPK1)
   04658 Th1 and Th2 cell differentiation
    107497830 (MAPK1)
   04659 Th17 cell differentiation
    107497830 (MAPK1)
   04657 IL-17 signaling pathway
    107497830 (MAPK1)
   04662 B cell receptor signaling pathway
    107497830 (MAPK1)
   04664 Fc epsilon RI signaling pathway
    107497830 (MAPK1)
   04666 Fc gamma R-mediated phagocytosis
    107497830 (MAPK1)
   04062 Chemokine signaling pathway
    107497830 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107497830 (MAPK1)
   04929 GnRH secretion
    107497830 (MAPK1)
   04912 GnRH signaling pathway
    107497830 (MAPK1)
   04915 Estrogen signaling pathway
    107497830 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    107497830 (MAPK1)
   04917 Prolactin signaling pathway
    107497830 (MAPK1)
   04921 Oxytocin signaling pathway
    107497830 (MAPK1)
   04926 Relaxin signaling pathway
    107497830 (MAPK1)
   04935 Growth hormone synthesis, secretion and action
    107497830 (MAPK1)
   04919 Thyroid hormone signaling pathway
    107497830 (MAPK1)
   04928 Parathyroid hormone synthesis, secretion and action
    107497830 (MAPK1)
   04916 Melanogenesis
    107497830 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107497830 (MAPK1)
   04270 Vascular smooth muscle contraction
    107497830 (MAPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    107497830 (MAPK1)
  09156 Nervous system
   04724 Glutamatergic synapse
    107497830 (MAPK1)
   04725 Cholinergic synapse
    107497830 (MAPK1)
   04726 Serotonergic synapse
    107497830 (MAPK1)
   04720 Long-term potentiation
    107497830 (MAPK1)
   04730 Long-term depression
    107497830 (MAPK1)
   04723 Retrograde endocannabinoid signaling
    107497830 (MAPK1)
   04722 Neurotrophin signaling pathway
    107497830 (MAPK1)
  09158 Development and regeneration
   04360 Axon guidance
    107497830 (MAPK1)
   04380 Osteoclast differentiation
    107497830 (MAPK1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107497830 (MAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107497830 (MAPK1)
   05206 MicroRNAs in cancer
    107497830 (MAPK1)
   05205 Proteoglycans in cancer
    107497830 (MAPK1)
   05203 Viral carcinogenesis
    107497830 (MAPK1)
   05230 Central carbon metabolism in cancer
    107497830 (MAPK1)
   05231 Choline metabolism in cancer
    107497830 (MAPK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107497830 (MAPK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107497830 (MAPK1)
   05212 Pancreatic cancer
    107497830 (MAPK1)
   05225 Hepatocellular carcinoma
    107497830 (MAPK1)
   05226 Gastric cancer
    107497830 (MAPK1)
   05214 Glioma
    107497830 (MAPK1)
   05216 Thyroid cancer
    107497830 (MAPK1)
   05221 Acute myeloid leukemia
    107497830 (MAPK1)
   05220 Chronic myeloid leukemia
    107497830 (MAPK1)
   05218 Melanoma
    107497830 (MAPK1)
   05211 Renal cell carcinoma
    107497830 (MAPK1)
   05219 Bladder cancer
    107497830 (MAPK1)
   05215 Prostate cancer
    107497830 (MAPK1)
   05213 Endometrial cancer
    107497830 (MAPK1)
   05224 Breast cancer
    107497830 (MAPK1)
   05223 Non-small cell lung cancer
    107497830 (MAPK1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107497830 (MAPK1)
   05020 Prion disease
    107497830 (MAPK1)
   05022 Pathways of neurodegeneration - multiple diseases
    107497830 (MAPK1)
  09165 Substance dependence
   05034 Alcoholism
    107497830 (MAPK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107497830 (MAPK1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107497830 (MAPK1)
   04934 Cushing syndrome
    107497830 (MAPK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107497830 (MAPK1)
   05135 Yersinia infection
    107497830 (MAPK1)
   05133 Pertussis
    107497830 (MAPK1)
   05152 Tuberculosis
    107497830 (MAPK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107497830 (MAPK1)
   05170 Human immunodeficiency virus 1 infection
    107497830 (MAPK1)
   05161 Hepatitis B
    107497830 (MAPK1)
   05160 Hepatitis C
    107497830 (MAPK1)
   05171 Coronavirus disease - COVID-19
    107497830 (MAPK1)
   05164 Influenza A
    107497830 (MAPK1)
   05163 Human cytomegalovirus infection
    107497830 (MAPK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107497830 (MAPK1)
   05165 Human papillomavirus infection
    107497830 (MAPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107497830 (MAPK1)
   05140 Leishmaniasis
    107497830 (MAPK1)
   05142 Chagas disease
    107497830 (MAPK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107497830 (MAPK1)
   01524 Platinum drug resistance
    107497830 (MAPK1)
   01522 Endocrine resistance
    107497830 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107497830 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ray03036]
    107497830 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107497830 (MAPK1)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107497830 (MAPK1)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107497830 (MAPK1)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     107497830 (MAPK1)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107497830 (MAPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH FTA2 Choline_kinase Kdo Kinase-like
Other DBs
NCBI-GeneID: 107497830
NCBI-ProteinID: XP_015975605
LinkDB
Position
Unknown
AA seq 360 aa
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFE
HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQH
LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDH
TGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHI
LGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
RIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcgggcgcgggcccggagatggtccgcgggcaggtgttcgac
gtggggccgcgctacaccaacctctcgtacatcggcgagggcgcctacggcatggtgtgc
tctgcttatgataatgtcaacaaagttcgagtagctatcaagaaaatcagtccttttgag
caccagacctactgccagagaaccctgagggagataaaaatcttactgcgcttcagacac
gagaacatcattggaatcaatgatattattcgagcgccaaccatcgagcaaatgaaagat
gtatatatagtgcaggacctcatggaaacagatctctacaagctcttgaagacacaacac
ctcagcaacgaccatatctgctattttctttaccagatcctcagagggttaaagtatatc
cattcagctaatgtgctacaccgtgacctcaaaccttccaacctgctgctcaacaccacc
tgtgatctcaagatctgtgattttggcttggcccgtgttgcagatccagaccatgatcac
acagggttcctgacggagtatgtagccacacgttggtacagggctccagaaattatgttg
aattccaagggctataccaagtccattgatatttggtctgtaggctgcattctggcagag
atgctctccaacaggcccatcttccccgggaagcactatcttgaccagctgaaccacatt
ctgggtattcttggatccccatcacaggaagacctgaattgcataatcaatttaaaagct
agaaactatttgctttctcttccacacaaaaataaggtgccatggaacagattgttccca
aatgctgactccaaagctctggatttactggacaaaatgttgactttcaaccctcacaag
aggattgaagtagaacaggcgctggctcacccatatctggagcagtattatgacccaagt
gatgagcccattgctgaagcaccgttcaagtttgacatggaattggatgacttgcctaag
gagaagctcaaagaactcatttttgaagagactgctagattccagccaggatacagatct
taa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107515836
Entry
107515836         CDS       T06036                                 

Gene name
MAPK3
Definition
(RefSeq) mitogen-activated protein kinase 3 isoform X1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray01522  Endocrine resistance
ray01524  Platinum drug resistance
ray04010  MAPK signaling pathway
ray04012  ErbB signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04024  cAMP signaling pathway
ray04062  Chemokine signaling pathway
ray04066  HIF-1 signaling pathway
ray04068  FoxO signaling pathway
ray04071  Sphingolipid signaling pathway
ray04072  Phospholipase D signaling pathway
ray04114  Oocyte meiosis
ray04140  Autophagy - animal
ray04150  mTOR signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04210  Apoptosis
ray04218  Cellular senescence
ray04261  Adrenergic signaling in cardiomyocytes
ray04270  Vascular smooth muscle contraction
ray04350  TGF-beta signaling pathway
ray04360  Axon guidance
ray04370  VEGF signaling pathway
ray04371  Apelin signaling pathway
ray04380  Osteoclast differentiation
ray04510  Focal adhesion
ray04520  Adherens junction
ray04540  Gap junction
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04611  Platelet activation
ray04613  Neutrophil extracellular trap formation
ray04620  Toll-like receptor signaling pathway
ray04621  NOD-like receptor signaling pathway
ray04625  C-type lectin receptor signaling pathway
ray04650  Natural killer cell mediated cytotoxicity
ray04657  IL-17 signaling pathway
ray04658  Th1 and Th2 cell differentiation
ray04659  Th17 cell differentiation
ray04660  T cell receptor signaling pathway
ray04662  B cell receptor signaling pathway
ray04664  Fc epsilon RI signaling pathway
ray04666  Fc gamma R-mediated phagocytosis
ray04668  TNF signaling pathway
ray04713  Circadian entrainment
ray04720  Long-term potentiation
ray04722  Neurotrophin signaling pathway
ray04723  Retrograde endocannabinoid signaling
ray04724  Glutamatergic synapse
ray04725  Cholinergic synapse
ray04726  Serotonergic synapse
ray04730  Long-term depression
ray04810  Regulation of actin cytoskeleton
ray04910  Insulin signaling pathway
ray04912  GnRH signaling pathway
ray04914  Progesterone-mediated oocyte maturation
ray04915  Estrogen signaling pathway
ray04916  Melanogenesis
ray04917  Prolactin signaling pathway
ray04919  Thyroid hormone signaling pathway
ray04921  Oxytocin signaling pathway
ray04926  Relaxin signaling pathway
ray04928  Parathyroid hormone synthesis, secretion and action
ray04929  GnRH secretion
ray04930  Type II diabetes mellitus
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray04934  Cushing syndrome
ray04935  Growth hormone synthesis, secretion and action
ray04960  Aldosterone-regulated sodium reabsorption
ray05010  Alzheimer disease
ray05020  Prion disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05034  Alcoholism
ray05132  Salmonella infection
ray05133  Pertussis
ray05135  Yersinia infection
ray05140  Leishmaniasis
ray05142  Chagas disease
ray05145  Toxoplasmosis
ray05152  Tuberculosis
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05163  Human cytomegalovirus infection
ray05164  Influenza A
ray05165  Human papillomavirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05170  Human immunodeficiency virus 1 infection
ray05171  Coronavirus disease - COVID-19
ray05200  Pathways in cancer
ray05203  Viral carcinogenesis
ray05205  Proteoglycans in cancer
ray05206  MicroRNAs in cancer
ray05210  Colorectal cancer
ray05211  Renal cell carcinoma
ray05212  Pancreatic cancer
ray05213  Endometrial cancer
ray05214  Glioma
ray05215  Prostate cancer
ray05216  Thyroid cancer
ray05218  Melanoma
ray05219  Bladder cancer
ray05220  Chronic myeloid leukemia
ray05221  Acute myeloid leukemia
ray05223  Non-small cell lung cancer
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
ray05230  Central carbon metabolism in cancer
ray05231  Choline metabolism in cancer
ray05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107515836 (MAPK3)
   04012 ErbB signaling pathway
    107515836 (MAPK3)
   04014 Ras signaling pathway
    107515836 (MAPK3)
   04015 Rap1 signaling pathway
    107515836 (MAPK3)
   04350 TGF-beta signaling pathway
    107515836 (MAPK3)
   04370 VEGF signaling pathway
    107515836 (MAPK3)
   04371 Apelin signaling pathway
    107515836 (MAPK3)
   04668 TNF signaling pathway
    107515836 (MAPK3)
   04066 HIF-1 signaling pathway
    107515836 (MAPK3)
   04068 FoxO signaling pathway
    107515836 (MAPK3)
   04072 Phospholipase D signaling pathway
    107515836 (MAPK3)
   04071 Sphingolipid signaling pathway
    107515836 (MAPK3)
   04024 cAMP signaling pathway
    107515836 (MAPK3)
   04022 cGMP-PKG signaling pathway
    107515836 (MAPK3)
   04151 PI3K-Akt signaling pathway
    107515836 (MAPK3)
   04150 mTOR signaling pathway
    107515836 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107515836 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    107515836 (MAPK3)
   04210 Apoptosis
    107515836 (MAPK3)
   04218 Cellular senescence
    107515836 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107515836 (MAPK3)
   04520 Adherens junction
    107515836 (MAPK3)
   04540 Gap junction
    107515836 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    107515836 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107515836 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107515836 (MAPK3)
   04613 Neutrophil extracellular trap formation
    107515836 (MAPK3)
   04620 Toll-like receptor signaling pathway
    107515836 (MAPK3)
   04621 NOD-like receptor signaling pathway
    107515836 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    107515836 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    107515836 (MAPK3)
   04660 T cell receptor signaling pathway
    107515836 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    107515836 (MAPK3)
   04659 Th17 cell differentiation
    107515836 (MAPK3)
   04657 IL-17 signaling pathway
    107515836 (MAPK3)
   04662 B cell receptor signaling pathway
    107515836 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    107515836 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    107515836 (MAPK3)
   04062 Chemokine signaling pathway
    107515836 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107515836 (MAPK3)
   04929 GnRH secretion
    107515836 (MAPK3)
   04912 GnRH signaling pathway
    107515836 (MAPK3)
   04915 Estrogen signaling pathway
    107515836 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    107515836 (MAPK3)
   04917 Prolactin signaling pathway
    107515836 (MAPK3)
   04921 Oxytocin signaling pathway
    107515836 (MAPK3)
   04926 Relaxin signaling pathway
    107515836 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    107515836 (MAPK3)
   04919 Thyroid hormone signaling pathway
    107515836 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    107515836 (MAPK3)
   04916 Melanogenesis
    107515836 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107515836 (MAPK3)
   04270 Vascular smooth muscle contraction
    107515836 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    107515836 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    107515836 (MAPK3)
   04725 Cholinergic synapse
    107515836 (MAPK3)
   04726 Serotonergic synapse
    107515836 (MAPK3)
   04720 Long-term potentiation
    107515836 (MAPK3)
   04730 Long-term depression
    107515836 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    107515836 (MAPK3)
   04722 Neurotrophin signaling pathway
    107515836 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    107515836 (MAPK3)
   04380 Osteoclast differentiation
    107515836 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107515836 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107515836 (MAPK3)
   05206 MicroRNAs in cancer
    107515836 (MAPK3)
   05205 Proteoglycans in cancer
    107515836 (MAPK3)
   05203 Viral carcinogenesis
    107515836 (MAPK3)
   05230 Central carbon metabolism in cancer
    107515836 (MAPK3)
   05231 Choline metabolism in cancer
    107515836 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107515836 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107515836 (MAPK3)
   05212 Pancreatic cancer
    107515836 (MAPK3)
   05225 Hepatocellular carcinoma
    107515836 (MAPK3)
   05226 Gastric cancer
    107515836 (MAPK3)
   05214 Glioma
    107515836 (MAPK3)
   05216 Thyroid cancer
    107515836 (MAPK3)
   05221 Acute myeloid leukemia
    107515836 (MAPK3)
   05220 Chronic myeloid leukemia
    107515836 (MAPK3)
   05218 Melanoma
    107515836 (MAPK3)
   05211 Renal cell carcinoma
    107515836 (MAPK3)
   05219 Bladder cancer
    107515836 (MAPK3)
   05215 Prostate cancer
    107515836 (MAPK3)
   05213 Endometrial cancer
    107515836 (MAPK3)
   05224 Breast cancer
    107515836 (MAPK3)
   05223 Non-small cell lung cancer
    107515836 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107515836 (MAPK3)
   05020 Prion disease
    107515836 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    107515836 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    107515836 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107515836 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107515836 (MAPK3)
   04934 Cushing syndrome
    107515836 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107515836 (MAPK3)
   05135 Yersinia infection
    107515836 (MAPK3)
   05133 Pertussis
    107515836 (MAPK3)
   05152 Tuberculosis
    107515836 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107515836 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    107515836 (MAPK3)
   05161 Hepatitis B
    107515836 (MAPK3)
   05160 Hepatitis C
    107515836 (MAPK3)
   05171 Coronavirus disease - COVID-19
    107515836 (MAPK3)
   05164 Influenza A
    107515836 (MAPK3)
   05163 Human cytomegalovirus infection
    107515836 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107515836 (MAPK3)
   05165 Human papillomavirus infection
    107515836 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107515836 (MAPK3)
   05140 Leishmaniasis
    107515836 (MAPK3)
   05142 Chagas disease
    107515836 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107515836 (MAPK3)
   01524 Platinum drug resistance
    107515836 (MAPK3)
   01522 Endocrine resistance
    107515836 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107515836 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ray03036]
    107515836 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107515836 (MAPK3)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107515836 (MAPK3)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107515836 (MAPK3)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     107515836 (MAPK3)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107515836 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Choline_kinase FTA2
Other DBs
NCBI-GeneID: 107515836
NCBI-ProteinID: XP_016010506
LinkDB
Position
Unknown
AA seq 412 aa
MAAAAAAPQGGGGGEHRGADGVDPGVSGEVEIVKGQPFDVGPRYTQLQYIGEGAYGMVSS
AYDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFHHENVIGIRDILRAPTLEAMRDV
YIVQDLMETDLYKLLKSQQLSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTC
DLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEM
LSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPK
SDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEVGQPPAAGLEGKWVGRHPS
VPDLSFTSLPPQPVAEEPFTFDMELDDLPKERLKELIFQETARFQPGVLEAP
NT seq 1239 nt   +upstreamnt  +downstreamnt
atggcggcggccgcggcggcgcctcaggggggcggaggcggggagcaccggggagctgat
ggggtcgacccgggggtctctggggaagtggagatagtgaaggggcagccgttcgacgtg
ggcccgcgctacacgcaactgcagtacatcggcgagggcgcctatggcatggtcagctca
gcttacgaccatgtgcgcaagacacgcgtagccatcaagaaaatcagccccttcgagcat
cagacctactgccagcgcacactgcgggagatccagatcttgctgcgcttccaccatgag
aatgtcattggcatccgagatattctgcgtgcacccaccctggaagccatgagggatgtc
tacattgttcaggacctgatggagacagacctgtacaagttgctcaaaagccaacagctg
agcaacgaccatgtctgctacttcctctaccagatcctgcggggcctcaagtatattcac
tcagccaacgtactccaccgggatttaaagccctccaacctgctcatcaacaccacctgc
gaccttaagatctgcgattttggcctggcccggatcgccgatcctgagcatgaccacact
ggattcctgacagaatacgtggccacacgctggtaccgggccccagagatcatgcttaac
tccaagggctacaccaagtccatcgacatctggtctgtgggctgcattctggctgagatg
ctctccaaccggcccatctttcctggcaagcactacctggaccagctcaaccatattctg
ggtatcctgggctccccatctcaggaggacctgaattgtatcatcaacatgaaggcccga
aactatctacagtctctgccctccaagaccaaggtggcctgggccaagctttttcccaag
tcagactccaaagcccttgacctgctggaccggatgttgacctttaaccccaataaacgg
atcacagtggaagaagccttggctcacccctacctggagcagtactacgacccaacagat
gaggtgggccagcctccagcagctggactggagggtaagtgggtgggtaggcatccttca
gtacctgacctgagctttacttctttgccaccccagccggtggccgaggaacctttcact
ttcgacatggagctggatgatctacccaaggagcggctgaaggagctcatattccaggag
acagcccgcttccagcctggggtgctggaggccccctaa

DBGET integrated database retrieval system