KEGG   Rousettus aegyptiacus (Egyptian rousette): 107497847
Entry
107497847         CDS       T06036                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: tubulin alpha-3 chain-like
  KO
K07374  tubulin alpha
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04145  Phagosome
ray04210  Apoptosis
ray04530  Tight junction
ray04540  Gap junction
ray05010  Alzheimer disease
ray05012  Parkinson disease
ray05014  Amyotrophic lateral sclerosis
ray05016  Huntington disease
ray05020  Prion disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107497847
  09143 Cell growth and death
   04210 Apoptosis
    107497847
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107497847
   04540 Gap junction
    107497847
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107497847
   05012 Parkinson disease
    107497847
   05014 Amyotrophic lateral sclerosis
    107497847
   05016 Huntington disease
    107497847
   05020 Prion disease
    107497847
   05022 Pathways of neurodegeneration - multiple diseases
    107497847
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107497847
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ray03019]
    107497847
   03036 Chromosome and associated proteins [BR:ray03036]
    107497847
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107497847
   04147 Exosome [BR:ray04147]
    107497847
Messenger RNA biogenesis [BR:ray03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     107497847
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     107497847
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    107497847
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107497847
  Exosomal proteins of other body fluids (saliva and urine)
   107497847
  Exosomal proteins of colorectal cancer cells
   107497847
SSDB
Motif
Pfam: Tubulin Tubulin_C Tubulin_3
Other DBs
NCBI-GeneID: 107497847
NCBI-ProteinID: XP_015975653
LinkDB
Position
Unknown
AA seq 450 aa
MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK
HVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLD
RIRKLADLCTGLQGFLIFHSFGGGTGSGFASLLMERLSVDYGKKSKLEFAIYPAPQVSTA
VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITA
SLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN
QMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPP
TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDLAALEKDYEEVGVDSVEAEAEEGEEY
NT seq 1353 nt   +upstreamnt  +downstreamnt
atgcgagagtgcatttctatccacgtgggacaggccggtgtccagatcggcaatgcctgc
tgggaattgtattgccttgaacatggaattcagcccgatgggcaaatgccaagtgacaaa
accatcggcggtggggatgactccttcaatacgttcttcagcgagactggggctggcaag
catgtgcccagagcagtgtttgtggacctggagcccaccgtggtcgatgaagtgcgcaca
gggacttacaggcagctcttccatccggagcaactgatcactggaaaggaagatgcagcc
aataattacgccagaggccattacaccatcggcaaggagattgttgacctggtcctggat
cggatccgcaaactggcggatctgtgcacggggctgcagggcttcctcatcttccacagc
ttcgggggcggcaccggctctgggtttgcatctctgctcatggagcggctctcggtggac
tacggcaagaagtccaagctcgaatttgccatttacccagccccccaggtgtccacggct
gtggtggagccctacaactccatcctgaccacccacacaaccttggaacattccgactgt
gccttcatggtggacaatgaggccatctacgacatatgtcggcgcaacctggacatcgag
cggcccacgtacaccaacctcaatcgtctgattgggcagatcgtgtcctccatcacggcc
tccctgcgcttcgacggggccctgaacgtggacttgacggaattccagaccaacctggtc
ccgtacccccgcatccacttccccctggccacctacgccccagtcatctctgcagagaag
gcctaccacgagcagttgtctgtggctgagatcaccaatgcctgcttcgagccggccaat
cagatggttaagtgtgaccctcgccacggcaagtacatggcctgctgcatgttgtacagg
ggggatgtggttccgaaagatgtcaacgcggccatcgccaccatcaagaccaagcgcacc
atccagtttgtggattggtgcccaacaggatttaaggtgggcatcaactaccagccccca
accgttgtccctgggggagacctggccaaggtgcagcgggccgtgtgcatgctgagcaat
accaccgccattgctgaggcctgggcccgcctggaccataagttcgatctcatgtatgca
aagcgagcctttgtgcactggtatgtgggggaaggcatggaggaaggggagttctccgag
gcccgggaggacctggcagctctggagaaagattatgaagaggtgggtgtggattctgtg
gaagcagaggccgaagaaggggaagaatactga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107497857
Entry
107497857         CDS       T06036                                 

Definition
(RefSeq) tubulin alpha-3 chain-like
  KO
K07374  tubulin alpha
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04145  Phagosome
ray04210  Apoptosis
ray04530  Tight junction
ray04540  Gap junction
ray05010  Alzheimer disease
ray05012  Parkinson disease
ray05014  Amyotrophic lateral sclerosis
ray05016  Huntington disease
ray05020  Prion disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107497857
  09143 Cell growth and death
   04210 Apoptosis
    107497857
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107497857
   04540 Gap junction
    107497857
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107497857
   05012 Parkinson disease
    107497857
   05014 Amyotrophic lateral sclerosis
    107497857
   05016 Huntington disease
    107497857
   05020 Prion disease
    107497857
   05022 Pathways of neurodegeneration - multiple diseases
    107497857
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107497857
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ray03019]
    107497857
   03036 Chromosome and associated proteins [BR:ray03036]
    107497857
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107497857
   04147 Exosome [BR:ray04147]
    107497857
Messenger RNA biogenesis [BR:ray03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     107497857
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     107497857
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    107497857
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107497857
  Exosomal proteins of other body fluids (saliva and urine)
   107497857
  Exosomal proteins of colorectal cancer cells
   107497857
SSDB
Motif
Pfam: Tubulin Tubulin_C Tubulin_3
Other DBs
NCBI-GeneID: 107497857
NCBI-ProteinID: XP_015975676
LinkDB
Position
Unknown
AA seq 465 aa
MRWVSHLCSGSQRECISIYVGQGGVQIDNACWELYCLEHGIQLDGQMASDKTIGGGDDSF
NTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITEKEDAANNYARGHYA
RGHYTIGKEIVDLVLDRIRKPADLCTGLQGFLIFHSFGGGTGSGFASLLMERLSVDYGKK
SKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTY
TNLYRLIGQIVSSITASLHFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHE
QLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFV
DWCPTGFKMGINYQPLTIVPGGDVAKVQRAVCMLSITTAIAKAWARLDYKFDLMYAKRAF
VHWYMGEGMEKGEFSEAREDLAALEKDYEEVGVDSVEAEAEGEEY
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgaggtgggtctcacatttatgttctggttcccagcgagagtgtatttctatctacgtg
ggacagggcggtgtccagatcgacaatgcctgctgggaattgtattgccttgaacatgga
attcagcttgatgggcaaatggcaagtgacaaaaccatcggcggtggggatgactccttc
aatacgttcttcagcgagactggggctggcaagcatgtgcccagagcagtgtttgtggac
ctggagcccaccgtggtcgatgaagtgcgcacagggacttacaggcagctcttccatccg
gagcaactgatcactgaaaaggaagatgcagccaataattatgccagaggccattacgcc
agaggccattacaccatcggcaaggagattgttgacctggtcctggaccggatccgcaaa
ccggcggatctgtgcacggggctgcagggcttcctcatcttccacagcttcgggggcggc
accggctctgggtttgcatctctgctcatggagcggctctcggtggactacggcaagaag
tccaagctcgaatttgccatttacccagccccccaggtgtccacggctgtggtggagccc
tacaactccatcctgaccacccacacaaccttggaacattccgactgtgccttcatggtg
gacaatgaggccatctacgacatatgtcggcgcaacctggacatcgagcgtcccacgtac
accaacctctatcgtctgattgggcagatcgtgtcctccatcacggcctccctgcacttc
gacggggccctgaacgtggacttgacggaattccagaccaacctggtcccatacccccgc
atccacttccccctggccacctacgccccggtcatctctgcagagaaggcctaccacgag
cagttgtctgtggctgagatcaccaatgcctgcttcgagccggccaatcagatggtcaag
tgtgaccctcgccacggcaagtacatggcctgctgcatgttgtacaggggggacgtggtt
ccgaaagatgtcaacgcggccatcgccaccatcaagaccaagcgcaccatccagtttgtg
gattggtgcccaacaggatttaagatgggcatcaactaccagcccctcaccattgtccct
gggggagacgtggccaaggtgcagcgggccgtgtgcatgctgagcatcaccaccgccatt
gccaaggcctgggcccgcctggactataagtttgatctcatgtatgcaaagcgagccttt
gtacactggtatatgggggagggcatggagaaaggggagttctccgaggcccgggaggac
ctggcagctctggagaaagattatgaagaggtgggcgtggattctgtggaagccgaggcc
gaaggagaagagtactga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107500328
Entry
107500328         CDS       T06036                                 

Gene name
TUBA8
Definition
(RefSeq) tubulin alpha-8 chain isoform X1
  KO
K07374  tubulin alpha
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04145  Phagosome
ray04210  Apoptosis
ray04530  Tight junction
ray04540  Gap junction
ray05010  Alzheimer disease
ray05012  Parkinson disease
ray05014  Amyotrophic lateral sclerosis
ray05016  Huntington disease
ray05020  Prion disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107500328 (TUBA8)
  09143 Cell growth and death
   04210 Apoptosis
    107500328 (TUBA8)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107500328 (TUBA8)
   04540 Gap junction
    107500328 (TUBA8)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107500328 (TUBA8)
   05012 Parkinson disease
    107500328 (TUBA8)
   05014 Amyotrophic lateral sclerosis
    107500328 (TUBA8)
   05016 Huntington disease
    107500328 (TUBA8)
   05020 Prion disease
    107500328 (TUBA8)
   05022 Pathways of neurodegeneration - multiple diseases
    107500328 (TUBA8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107500328 (TUBA8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ray03019]
    107500328 (TUBA8)
   03036 Chromosome and associated proteins [BR:ray03036]
    107500328 (TUBA8)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107500328 (TUBA8)
   04147 Exosome [BR:ray04147]
    107500328 (TUBA8)
Messenger RNA biogenesis [BR:ray03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     107500328 (TUBA8)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     107500328 (TUBA8)
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    107500328 (TUBA8)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107500328 (TUBA8)
  Exosomal proteins of other body fluids (saliva and urine)
   107500328 (TUBA8)
  Exosomal proteins of colorectal cancer cells
   107500328 (TUBA8)
SSDB
Motif
Pfam: Tubulin Tubulin_C Tubulin_3
Other DBs
NCBI-GeneID: 107500328
NCBI-ProteinID: XP_015980912
LinkDB
Position
Unknown
AA seq 449 aa
MRECISVHVGQAGVQIGNACWELFCLEHGIQADGTFSTQASKINDDDSFTTFFSETGNGK
HVPRAVMVDLEPTVVDEVRAGTYRQLFHPEQLITGKEDAANNYARGHYTVGKESIDLVLD
RIRKLTDACSGLQGFLIFHSFGGGTGSGFTSLLMERLSLDYGKKSKLEFAIYPAPQVSTA
VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITA
SLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYAPIISAEKAYHEQLSVAEITSSCFEPNS
QMVKCDPRHGKYMACCMLYRGDVVPKDVNVAIAAIKTKRTIQFVDWCPTGFKVGINYQPP
TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDLAALEKDYEEVGTDSFEEENEGEEF
NT seq 1350 nt   +upstreamnt  +downstreamnt
atgagggaatgcatatcggtccacgtgggtcaagcgggagttcagattggaaatgcctgc
tgggaactcttctgcctggaacatggcattcaggcagacggcacctttagtacccaggcc
agcaagatcaatgatgatgactcattcaccacctttttcagtgagaccggcaatgggaag
catgtgccccgggctgtcatggtagatctggaacccactgtagtagatgaagttcgagca
ggaacctaccgccagctcttccatccagagcagctgatcacaggaaaggaggatgcagct
aacaactatgcccggggccactacacagtgggcaaggagagcatcgacctggtgcttgac
cgcataaggaagctgacagatgcctgctctggcttgcaaggcttcctgatcttccacagt
tttggtgggggcactggctctggtttcacttctctgttgatggaacgcctttccttggat
tatggcaagaagtccaagctagagtttgctatctacccagccccccaggtctctactgca
gtggttgagccctataactccatcctgaccacccataccacactggaacattcagattgt
gcttttatggtggataatgaagctatctatgacatctgccgcaggaacttagacattgag
cgccccacctataccaacctcaaccgcctcatcagccagatcgtgtcctccatcactgcc
tctctccgctttgatggggcccttaatgtggacctcactgagttccagactaatctggtg
ccctaccctcgcatccacttcccactggtcacctatgcacccatcatatctgctgagaaa
gcctatcatgaacaactctcagtggctgaaataaccagctcctgctttgagcccaatagc
cagatggtgaagtgtgacccaagacatggcaagtacatggcctgctgcatgctctaccgt
ggcgacgtggtgcccaaagatgtgaatgtcgctattgctgccatcaagaccaagaggaca
attcagtttgtagactggtgtcccacaggcttcaaggtgggcatcaactaccagccaccc
acagtggtaccagggggggacctagccaaagtccagcgggctgtctgcatgctgagcaac
accacagcaattgcggaggcctgggcccgcctagaccacaagtttgacctcatgtatgcc
aagcgggcctttgtgcattggtatgttggagagggaatggaagaaggagaattttctgag
gccagggaggacctggctgctctggagaaggattatgaagaagtggggactgattcattt
gaagaagaaaatgaaggggaggaattttaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107514242
Entry
107514242         CDS       T06036                                 

Definition
(RefSeq) tubulin alpha-1A chain isoform X1
  KO
K07374  tubulin alpha
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04145  Phagosome
ray04210  Apoptosis
ray04530  Tight junction
ray04540  Gap junction
ray05010  Alzheimer disease
ray05012  Parkinson disease
ray05014  Amyotrophic lateral sclerosis
ray05016  Huntington disease
ray05020  Prion disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107514242
  09143 Cell growth and death
   04210 Apoptosis
    107514242
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107514242
   04540 Gap junction
    107514242
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107514242
   05012 Parkinson disease
    107514242
   05014 Amyotrophic lateral sclerosis
    107514242
   05016 Huntington disease
    107514242
   05020 Prion disease
    107514242
   05022 Pathways of neurodegeneration - multiple diseases
    107514242
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107514242
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ray03019]
    107514242
   03036 Chromosome and associated proteins [BR:ray03036]
    107514242
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107514242
   04147 Exosome [BR:ray04147]
    107514242
Messenger RNA biogenesis [BR:ray03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     107514242
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     107514242
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    107514242
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107514242
  Exosomal proteins of other body fluids (saliva and urine)
   107514242
  Exosomal proteins of colorectal cancer cells
   107514242
SSDB
Motif
Pfam: Tubulin Tubulin_C Tubulin_3
Other DBs
NCBI-GeneID: 107514242
NCBI-ProteinID: XP_016007247
LinkDB
Position
Unknown
AA seq 451 aa
MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK
HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLD
RIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTA
VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITA
SLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN
QMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPP
TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDMAALEKDYEEVGVDSVEGEGEEEGEEY
NT seq 1356 nt   +upstreamnt  +downstreamnt
atgcgtgagtgcatctccatccacgttggccaggctggtgttcagattggcaatgcctgc
tgggagctctactgcctggaacatggcatccaacctgatggccagatgccaagtgacaaa
accattggggggggagacgactccttcaacaccttcttcagcgagacaggcgctggcaag
cacgtgcccagggcagtgtttgtagacctggaacccacggtcattgatgaagttcgcact
ggcacctaccgccagctcttccaccccgagcagctcatcacaggcaaggaagatgccgcc
aataactatgctcgcggacactacaccattggcaaggagatcattgaccttgtcttagat
cgaattcggaagctggctgaccagtgcacaggtcttcagggcttcttggttttccatagc
tttggtgggggaactggttctgggttcacctccctgctgatggaacgtctctctgtcgat
tatggcaagaagtccaagctggagttctccatttacccagctccccaggtttccacagct
gtagttgagccctacaactccattctcaccacccacaccaccctagagcactctgattgt
gccttcatggtcgacaacgaggccatctatgacatctgtcgtagaaaccttgatattgag
cgcccaacctacactaacctgaatagattgataggtcaaattgtatcctccatcactgct
tccctgagatttgatggagccttgaatgttgatctgacagaattccagaccaacctggtg
ccctatcctcgtatccacttccctctggccacctatgcccctgtcatctctgctgagaaa
gcctaccatgaacagctttctgtagcagagattactaatgcgtgctttgagccagccaac
cagatggtaaaatgtgaccctcgccacggtaaatacatggcttgctgcctgttataccgt
ggggacgtggttcccaaagatgtcaatgctgccattgccaccatcaagaccaagcgtacc
atccagtttgtggactggtgccccactggcttcaaagttggcattaattaccagcctccc
actgtggtgcctggtggagacctagccaaagtacagcgagctgtgtgcatgctgagcaac
actacagctattgctgaggcctgggctcgcctggaccacaagtttgacctgatgtatgcc
aagcgtgcctttgttcactggtacgtgggtgagggcatggaggaaggagagttttctgag
gctcgtgaggacatggctgcccttgagaaggattatgaggaggttggtgtggattctgtt
gaaggagagggtgaggaagaaggagaggaatactaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107514243
Entry
107514243         CDS       T06036                                 

Definition
(RefSeq) tubulin alpha-1C chain
  KO
K07374  tubulin alpha
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04145  Phagosome
ray04210  Apoptosis
ray04530  Tight junction
ray04540  Gap junction
ray05010  Alzheimer disease
ray05012  Parkinson disease
ray05014  Amyotrophic lateral sclerosis
ray05016  Huntington disease
ray05020  Prion disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107514243
  09143 Cell growth and death
   04210 Apoptosis
    107514243
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107514243
   04540 Gap junction
    107514243
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107514243
   05012 Parkinson disease
    107514243
   05014 Amyotrophic lateral sclerosis
    107514243
   05016 Huntington disease
    107514243
   05020 Prion disease
    107514243
   05022 Pathways of neurodegeneration - multiple diseases
    107514243
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107514243
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ray03019]
    107514243
   03036 Chromosome and associated proteins [BR:ray03036]
    107514243
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107514243
   04147 Exosome [BR:ray04147]
    107514243
Messenger RNA biogenesis [BR:ray03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     107514243
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     107514243
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    107514243
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107514243
  Exosomal proteins of other body fluids (saliva and urine)
   107514243
  Exosomal proteins of colorectal cancer cells
   107514243
SSDB
Motif
Pfam: Tubulin Tubulin_C Tubulin_3
Other DBs
NCBI-GeneID: 107514243
NCBI-ProteinID: XP_016007249
LinkDB
Position
Unknown
AA seq 449 aa
MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK
HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLD
RIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTA
VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITA
SLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNACFEPAN
QMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPP
TVVPGGDLAKVQRAVCMLSNTTAVAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDMAALEKDYEEVGADSAEGEDEGEEY
NT seq 1350 nt   +upstreamnt  +downstreamnt
atgcgtgagtgcatctccatccatgttggccaggctggtgttcagattggcaatgcctgc
tgggagctctactgcctggaacatggcatccagcctgatggccagatgccaagtgacaaa
accattggggggggagacgactccttcaacaccttcttcagcgagacaggtgctggcaag
cacgtgcccagggcagtgtttgtagacctggaacccacggtcattgatgaagttcgcact
ggcacctaccgccagctcttccaccccgagcagctcatcacaggcaaggaagatgccgcc
aataactatgctcgcggacactacaccattggcaaggagatcattgaccttgtcttggac
cgaattcggaagctggctgaccagtgcacaggtcttcagggcttcttggttttccatagc
tttggtgggggaactggttccgggttcacctccctgctgatggaacgtctctctgtcgat
tatggcaagaagtccaagctggagttctccatttacccagccccccaggtttccacagct
gtagttgagccctacaactccatcctcaccacccacaccaccctagagcactctgattgt
gccttcatggtcgacaacgaggccatctatgacatctgtcgtagaaaccttgatattgag
cgcccaacctacactaacctgaaccgccttattagccagattgtgtcctccatcactgct
tccctgagatttgatggagccctgaatgttgatctgacagaattccagaccaacctggtg
ccctatcctcgcatccacttccctctggccacctatgcccctgtcatctctgctgagaaa
gcctaccatgaacagcttactgtagcagagatcaccaatgcgtgctttgagccagccaac
cagatggtaaaatgtgaccctcgccacggtaaatacatggcttgctgcctgttgtaccgt
ggggacgtggttcccaaagatgtcaatgctgccattgccaccatcaagaccaagcgcagc
atccagtttgtggactggtgtcccactggcttcaaagttggcattaattaccagcctccc
actgtggtgcctggtggagacctagccaaagtacagcgagccgtatgcatgctgagcaac
actacagctgttgctgaggcctgggctcgcctggaccacaagtttgacctgatgtatgcc
aagcgtgcctttgttcactggtacgtgggtgagggcatggaggaaggagagttttctgag
gctcgtgaggacatggctgccctcgagaaggattatgaggaggttggagcagatagtgct
gagggagaggatgagggtgaagagtattaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107516732
Entry
107516732         CDS       T06036                                 

Definition
(RefSeq) tubulin alpha-4A chain isoform X1
  KO
K07374  tubulin alpha
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04145  Phagosome
ray04210  Apoptosis
ray04530  Tight junction
ray04540  Gap junction
ray05010  Alzheimer disease
ray05012  Parkinson disease
ray05014  Amyotrophic lateral sclerosis
ray05016  Huntington disease
ray05020  Prion disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107516732
  09143 Cell growth and death
   04210 Apoptosis
    107516732
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107516732
   04540 Gap junction
    107516732
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107516732
   05012 Parkinson disease
    107516732
   05014 Amyotrophic lateral sclerosis
    107516732
   05016 Huntington disease
    107516732
   05020 Prion disease
    107516732
   05022 Pathways of neurodegeneration - multiple diseases
    107516732
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107516732
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ray03019]
    107516732
   03036 Chromosome and associated proteins [BR:ray03036]
    107516732
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107516732
   04147 Exosome [BR:ray04147]
    107516732
Messenger RNA biogenesis [BR:ray03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     107516732
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     107516732
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    107516732
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107516732
  Exosomal proteins of other body fluids (saliva and urine)
   107516732
  Exosomal proteins of colorectal cancer cells
   107516732
SSDB
Motif
Pfam: Tubulin Tubulin_C Tubulin_3
Other DBs
NCBI-GeneID: 107516732
NCBI-ProteinID: XP_016012237
LinkDB
Position
Unknown
AA seq 448 aa
MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFTTFFCETGAGK
HVPRAVFVDLEPTVIDEIRNGPYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDPVLD
RIRKLSDQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTA
VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITA
SLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN
QMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIAAIKTKRSIQFVDWCPTGFKVGINYQPP
TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDMAALEKDYEEVGIDSYEDEDEGEE
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgcgtgaatgcatctcagtccatgtggggcaggcaggtgtccagatgggcaatgcctgc
tgggagctctattgtctggaacatgggattcagcctgatgggcagatgcccagtgacaag
accattggtggaggggacgactccttcactactttcttctgtgaaaccggcgctggaaag
cacgtgccccgggcggtttttgtggatttggagcccaccgtaattgatgagatccgaaac
ggtccctaccggcagctcttccacccagagcagctcatcactgggaaagaggatgccgca
aataactatgctcgtggtcactacaccatcggcaaggagatcattgacccagtattggac
cggatccgcaagctgtcagaccagtgcacaggacttcagggcttcctggtcttccacagc
ttcgggggtggcaccggctccggcttcacctcgctcctcatggagcggctctctgttgac
tatggcaagaaatccaagctggagttctccatctacccagcaccccaggtgtccacggcc
gtggtggagccctacaactccatcctgaccacccacaccaccctggagcactcagactgt
gccttcatggtggacaacgaagccatctatgacatctgccgccgcaacctggacatcgag
cgcccgacctacaccaacctcaaccgcctcatcagccagatcgtctcctccatcacagcc
tccctgcgcttcgacggggccctcaacgtggacctgacagagttccagaccaacctggtg
ccctaccctcgcatccacttccccctggccacctacgcgccagtcatctctgcggagaag
gcctaccacgagcagctgtcggtggcggagatcaccaatgcctgctttgagcctgccaac
cagatggtgaagtgtgatccccggcatggcaagtacatggcctgctgcctgctgtaccgt
ggagacgtggtgcccaaggatgtcaatgctgccattgccgccatcaagaccaagcgcagc
attcagtttgtggactggtgccccacgggtttcaaggttggtatcaactaccagccaccc
actgtggtgcccggcggggacctggccaaggtgcagcgtgccgtgtgcatgctgagcaac
acgaccgccattgccgaggcctgggcccgcctggaccacaagttcgacctgatgtatgcc
aagcgggcatttgtgcactggtatgtgggggagggcatggaggagggtgagttctctgag
gcccgggaggatatggctgccttggagaaagattacgaggaagtaggcatcgactcctat
gaggatgaggatgaaggagaagaatag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107516782
Entry
107516782         CDS       T06036                                 

Definition
(RefSeq) tubulin alpha-1B chain-like
  KO
K07374  tubulin alpha
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04145  Phagosome
ray04210  Apoptosis
ray04530  Tight junction
ray04540  Gap junction
ray05010  Alzheimer disease
ray05012  Parkinson disease
ray05014  Amyotrophic lateral sclerosis
ray05016  Huntington disease
ray05020  Prion disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107516782
  09143 Cell growth and death
   04210 Apoptosis
    107516782
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107516782
   04540 Gap junction
    107516782
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107516782
   05012 Parkinson disease
    107516782
   05014 Amyotrophic lateral sclerosis
    107516782
   05016 Huntington disease
    107516782
   05020 Prion disease
    107516782
   05022 Pathways of neurodegeneration - multiple diseases
    107516782
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107516782
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ray03019]
    107516782
   03036 Chromosome and associated proteins [BR:ray03036]
    107516782
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107516782
   04147 Exosome [BR:ray04147]
    107516782
Messenger RNA biogenesis [BR:ray03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     107516782
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     107516782
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    107516782
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107516782
  Exosomal proteins of other body fluids (saliva and urine)
   107516782
  Exosomal proteins of colorectal cancer cells
   107516782
SSDB
Motif
Pfam: Tubulin Tubulin_C Tubulin_3
Other DBs
NCBI-GeneID: 107516782
NCBI-ProteinID: XP_016012369
LinkDB
Position
Unknown
AA seq 451 aa
MRECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGADDSFNTFFSETGAGK
HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKELIDLVLD
RIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTA
VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITA
SLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN
QMVKCDPRHGKYMACCLLYRGDVVPKDVNTAIASIKTKRSIQFVDWCPTGFKVGINYQPP
TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDMAALEKDYEEVGIDSMEGEGDEEGEEY
NT seq 1356 nt   +upstreamnt  +downstreamnt
atgcgtgaatgcatctcagtccacgtggggcaggccggtgtgcagatcggcaatgcttgc
tgggagctctactgcttggaacacgggatccaaccagatgggcagatgcccagcgacaag
accattggaggagcggacgactcctttaacaccttctttagtgaaactggggcaggaaaa
catgtgccccgggcggtgtttgtggatctggaacccactgtgatagatgaggttcggacc
ggcacataccgccaacttttccatccagagcagctcatcacaggcaaggaagatgctgcc
aataactatgctcgcggccactacaccattggaaaggagctcattgacctggtgctggac
cggattcggaagctggctgaccagtgcacaggactccaagggttcctcatcttccacagc
tttgggggtggcaccggctccggcttcacctcgctcctcatggagcggctctctgttgac
tatggcaagaaatccaagctggagttctccatctacccagcaccccaggtgtccacggcc
gtggtggagccctacaactccatcctgaccacccacaccaccctggagcactcagactgt
gccttcatggtggacaacgaagccatctatgacatctgccgccgcaacctggacatcgag
cgcccgacctacaccaacctcaaccgcctcatcagccagatcgtctcctccatcacagcc
tccctgcgcttcgacggggccctcaacgtggacctgacagagttccagaccaacctggtg
ccctaccctcgcatccacttccccctggccacctatgcgccagtcatctctgcggagaag
gcctaccacgagcagctgtcggtggcggagatcaccaatgcctgcttcgagcctgccaac
cagatggtgaagtgtgatccccgccatggcaagtacatggcctgctgcctgctgtaccgt
ggagacgtggtgcccaaggatgtcaacaccgccattgcttccatcaagaccaagcgcagc
attcagtttgtggactggtgccccacgggtttcaaggttggtatcaactaccagccaccc
actgtggtgcccggcggggacctggccaaggtgcagcgtgccgtgtgcatgctgagcaac
acgaccgccatcgccgaggcctgggcccgcctggaccacaagttcgacctgatgtatgcc
aagcgggcatttgtgcactggtatgtgggggagggcatggaggagggtgagttctctgag
gcccgggaggacatggctgccttggagaaggattacgaggaggtgggcattgatagtatg
gagggagagggagatgaggaaggggaagaatactag

DBGET integrated database retrieval system