KEGG   Rousettus aegyptiacus (Egyptian rousette): 107497859
Entry
107497859         CDS       T06036                                 

Gene name
CRKL
Definition
(RefSeq) crk-like protein
  KO
K04438  C-crk adapter molecule crk
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04012  ErbB signaling pathway
ray04015  Rap1 signaling pathway
ray04062  Chemokine signaling pathway
ray04510  Focal adhesion
ray04666  Fc gamma R-mediated phagocytosis
ray04722  Neurotrophin signaling pathway
ray04810  Regulation of actin cytoskeleton
ray04910  Insulin signaling pathway
ray04935  Growth hormone synthesis, secretion and action
ray05100  Bacterial invasion of epithelial cells
ray05135  Yersinia infection
ray05163  Human cytomegalovirus infection
ray05170  Human immunodeficiency virus 1 infection
ray05200  Pathways in cancer
ray05206  MicroRNAs in cancer
ray05211  Renal cell carcinoma
ray05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107497859 (CRKL)
   04012 ErbB signaling pathway
    107497859 (CRKL)
   04015 Rap1 signaling pathway
    107497859 (CRKL)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107497859 (CRKL)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107497859 (CRKL)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    107497859 (CRKL)
   04062 Chemokine signaling pathway
    107497859 (CRKL)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107497859 (CRKL)
   04935 Growth hormone synthesis, secretion and action
    107497859 (CRKL)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107497859 (CRKL)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107497859 (CRKL)
   05206 MicroRNAs in cancer
    107497859 (CRKL)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    107497859 (CRKL)
   05211 Renal cell carcinoma
    107497859 (CRKL)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107497859 (CRKL)
   05100 Bacterial invasion of epithelial cells
    107497859 (CRKL)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107497859 (CRKL)
   05163 Human cytomegalovirus infection
    107497859 (CRKL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:ray04990]
    107497859 (CRKL)
Domain-containing proteins not elsewhere classified [BR:ray04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   107497859 (CRKL)
SSDB
Motif
Pfam: SH3_2 SH2 SH3_1 SH3_9 hSH3
Other DBs
NCBI-GeneID: 107497859
NCBI-ProteinID: XP_015975678
LinkDB
Position
Unknown
AA seq 303 aa
MSSARFDSSDRSAWYMGPVSRQEAQTRLQGQRHGMFLVRDSSTCPGDYVLSVSENSRVSH
YIINSLPNRRFKIGDQEFDHLPALLEFYKIHYLDTTTLIEPAPRYPSPSMGSVSAPNLPT
AEENLEYVRTLYDFPGNDAEDLPFKKGEILVIIEKPEEQWWSARNKDGRIGMIPVPYVEK
LVRSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSSTPGAAINPLPSTQNGPVFA
KAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIIDPQNPD
ENE
NT seq 912 nt   +upstreamnt  +downstreamnt
atgtcttctgccaggttcgactcctcagaccgctccgcctggtacatgggaccggtgtct
cgccaggaggcgcagacccggctccagggccagcgtcatggcatgttcctagtccgtgac
tcctccacctgcccaggggactatgtgctgtccgtgtctgagaactcccgggtctcccac
tacatcatcaactcgctgcccaaccgccgttttaagatcggggaccaggagtttgaccac
ttgccagccctgctggagttctacaagattcactacctggacacgaccaccctaatcgag
cctgcgcccaggtatccaagcccatcaatgggatctgtatcagcacccaacctgcctaca
gcagaagaaaatctggaatatgtacggactctctatgattttcctggaaatgatgctgaa
gacttgccctttaaaaagggtgagatcctggtgataatagagaagcctgaagaacagtgg
tggagtgcccggaacaaggacggccggattgggatgattcccgtcccttatgttgaaaag
cttgtgagatcctcaccacatggaaaacatggaaataggaattccaacagttatgggatc
ccagaacctgctcatgcatatgctcaacctcaaaccacaactcctctacctgcagtttcc
agtaccccgggggcagcaatcaaccctttgccatccacacagaatggacctgtctttgca
aaagcaatccagaaaagagtaccctgtgcttatgacaagactgccttggcattggaggtt
ggtgacattgtgaaagtcacaaggatgaatataaatggccagtgggaaggcgaagtaaat
gggcgcaaagggcttttcccctttacgcacgtcaaaatcattgaccctcagaacccagat
gaaaatgagtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107507729
Entry
107507729         CDS       T06036                                 

Gene name
CRK
Definition
(RefSeq) adapter molecule crk isoform X1
  KO
K04438  C-crk adapter molecule crk
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04012  ErbB signaling pathway
ray04015  Rap1 signaling pathway
ray04062  Chemokine signaling pathway
ray04510  Focal adhesion
ray04666  Fc gamma R-mediated phagocytosis
ray04722  Neurotrophin signaling pathway
ray04810  Regulation of actin cytoskeleton
ray04910  Insulin signaling pathway
ray04935  Growth hormone synthesis, secretion and action
ray05100  Bacterial invasion of epithelial cells
ray05135  Yersinia infection
ray05163  Human cytomegalovirus infection
ray05170  Human immunodeficiency virus 1 infection
ray05200  Pathways in cancer
ray05206  MicroRNAs in cancer
ray05211  Renal cell carcinoma
ray05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107507729 (CRK)
   04012 ErbB signaling pathway
    107507729 (CRK)
   04015 Rap1 signaling pathway
    107507729 (CRK)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107507729 (CRK)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107507729 (CRK)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    107507729 (CRK)
   04062 Chemokine signaling pathway
    107507729 (CRK)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107507729 (CRK)
   04935 Growth hormone synthesis, secretion and action
    107507729 (CRK)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107507729 (CRK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107507729 (CRK)
   05206 MicroRNAs in cancer
    107507729 (CRK)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    107507729 (CRK)
   05211 Renal cell carcinoma
    107507729 (CRK)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107507729 (CRK)
   05100 Bacterial invasion of epithelial cells
    107507729 (CRK)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107507729 (CRK)
   05163 Human cytomegalovirus infection
    107507729 (CRK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:ray04990]
    107507729 (CRK)
Domain-containing proteins not elsewhere classified [BR:ray04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   107507729 (CRK)
SSDB
Motif
Pfam: SH3_2 SH2 SH3_1 SH3_9 SH3_10 DUF3804
Other DBs
NCBI-GeneID: 107507729
NCBI-ProteinID: XP_015994440
LinkDB
Position
Unknown
AA seq 304 aa
MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHY
IINSSGPRPPVPPSPAQPPPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSR
SRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRG
MIPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIYA
RVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQNPD
EDFS
NT seq 915 nt   +upstreamnt  +downstreamnt
atggcgggcaacttcgactcggaggagcggagtagctggtactgggggcggttgagccgg
caggaggcggtggcgctgttgcagggccagcggcacggggtgttcctggtgcgggactcg
agcaccagccccggggactatgtgctcagcgtctccgagaactcacgcgtctcacactac
atcatcaacagcagcggcccgcgcccaccggtgccaccatcgccggcccagcctccgccc
ggggtgagcccctccagacttcgaataggagatcaagagtttgattcattgcctgcttta
ctggaattctacaaaatacactatttggacactacaacgttgatagaaccagtttccaga
tccaggcagggtagtggagtgattctcaggcaggaggaggcagagtatgtgcgagccctc
tttgactttaatgggaatgatgaagaagatcttccctttaagaaaggagacatcctgaga
atccgggataagcctgaagagcagtggtggaatgcagaggacagcgaaggcaagagaggg
atgattccagtcccttacgtggagaagtatagacctgcctccgcctcagtatcggctctg
attggaggtaaccaggagggttcccacccacagccactgggtgggccggagcctgggccc
tatgcccaacccagcgtcaacactccgctccctaacctccagaatgggcccatttatgcc
agggtaatccagaagcgagtccctaatgcctacgacaagacagccttggctttggaggtc
ggtgagctggtaaaggttacgaagattaatgtgagtggtcagtgggaaggggagtgtaat
ggcaaacgaggtcacttcccattcacacatgtccgtctgctggatcaacagaatcctgat
gaggacttcagctga

DBGET integrated database retrieval system