KEGG   Rousettus aegyptiacus (Egyptian rousette): 107497879
Entry
107497879         CDS       T06036                                 

Gene name
FKBP5
Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase FKBP5 isoform X1
  KO
K09571  FK506-binding protein 4/5 [EC:5.2.1.8]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04915  Estrogen signaling pathway
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107497879 (FKBP5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ray03110]
    107497879 (FKBP5)
Enzymes [BR:ray01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     107497879 (FKBP5)
Chaperones and folding catalysts [BR:ray03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    107497879 (FKBP5)
SSDB
Motif
Pfam: FKBP_C TPR_1 TPR_2 TPR_8 TPR_6 TPR_19 TPR_12 TPR_7 TPR_9 TPR_11 NARP1 Fis1_TPR_C PknG_TPR ANAPC3 DUF3856
Other DBs
NCBI-GeneID: 107497879
NCBI-ProteinID: XP_015975694
LinkDB
Position
Unknown
AA seq 454 aa
MTTDEGAKNNGGSPAAAVAELGEDITSKKDRGVLKIVKRVGNSEETPMIGDKVYVHYSGK
LANGKKFDSSHDRNEPFVFNLGKGQVIKAWDIGVATMKKGEMCHLLCKPEYAYGSAGSVP
KIPSNATLFFEIELLDFKGEDLFEDGGIIRRIRRKGEGYSNPNEGATVEIHLEGHCGGKM
FDCRDVIFIVGEGEDHDIPIGIDRALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNVE
LMYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYLQAVIQYGKIVSWLEM
EYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEA
QLLMNEFESAKGDFEKVLEVNPQNKAARLQISVCQKRAKEHNDRDRRIYANMFKKFAEQD
AKGEASKAVGKKTLEGVTNKEGQAAKEEKVEGIV
NT seq 1365 nt   +upstreamnt  +downstreamnt
atgactactgatgaaggtgccaagaacaatggaggaagcccggcagcagctgttgctgag
ctgggagaggatattacctctaaaaaagatagaggagtattaaagattgttaaaagagtg
gggaatagtgaggaaacaccaatgatcggagacaaagtttatgtccattacagtggaaaa
ttggcaaatggaaagaagtttgattccagtcatgatcgaaatgaaccatttgtctttaat
cttggcaaaggtcaagttatcaaggcatgggacattggggtggctaccatgaagaaagga
gagatgtgccatttactgtgcaaaccagaatatgcatacggctcagctggcagtgtcccc
aaaattccctcaaatgcaactctcttttttgagattgagctccttgatttcaaaggagag
gatttatttgaagatggaggcattatccgaagaatcagacggaaaggagaaggatactca
aacccaaacgaaggagctacagtagaaatccacctggaaggccactgtggtggaaagatg
tttgattgcagagatgtgatattcatcgttggtgaaggagaagaccacgacattccaatt
ggaatcgacagagccctggagaaaatgcagcgggaagagcaatgtattttatatcttgga
ccacggtatggttttggagaggcagggaagcctaaatttggcattgaacctaatgttgag
cttatgtatgaagttacacttaagagcttcgaaaaggccaaagaatcctgggagatggat
accaaagaaaaattggagcaggctgccattgtcaaagagaagggaactgtgtactttaag
ggaggcaagtatttgcaggcggtgattcaatatgggaagatagtatcatggttagagatg
gaatacggcttatcagaaaaggaatctaaagcttcagaatcgtttctgctcgctgccttc
ctgaacctggccatgtgttacctgaagctcagagagtacaccaaagccgtcgagtgctgt
gataaggcccttggactggacagtgccaatgagaagggtttgtacagaaggggtgaagcc
cagctgctcatgaacgagtttgagtcagccaagggtgactttgagaaagtgctggaagta
aatccccagaataaggccgcaagactgcagatctctgtgtgccagaaaagggctaaggag
cacaatgaccgggaccgcagaatatatgccaacatgttcaagaagtttgcagagcaggat
gcaaagggagaagccagtaaagcagtgggcaagaagactttagaaggggtcaccaataaa
gaaggtcaggcagcgaaagaggagaaagtggaaggcattgtatga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107502693
Entry
107502693         CDS       T06036                                 

Gene name
FKBP4
Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase FKBP4 isoform X1
  KO
K09571  FK506-binding protein 4/5 [EC:5.2.1.8]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04915  Estrogen signaling pathway
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107502693 (FKBP4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ray03110]
    107502693 (FKBP4)
Enzymes [BR:ray01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     107502693 (FKBP4)
Chaperones and folding catalysts [BR:ray03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    107502693 (FKBP4)
SSDB
Motif
Pfam: FKBP_C TPR_1 TPR_2 TPR_8 TPR_12 FKBP_N_2 TPR_11 TPR_6 TPR_16 TPR_14 TPR_19 PknG_TPR TPR_9 TPR_17 HP1451_C
Other DBs
NCBI-GeneID: 107502693
NCBI-ProteinID: XP_015985613
LinkDB
Position
Unknown
AA seq 460 aa
MTAEEMKGVESGVQTAPLPIEGVDISPKQDEGVLKVIKREGTGTETPMIGDRVVVHYTGW
LLDGTKFDSSLDHKDKFCFDLGKGEVIKAWDIAVATMKVGEVCHITCKPEYAYGLAGSPP
KIPPNATLVFEVELFEFKGEDLTEEEDGGIIRRIQTQGEGFAKPNDGALVEVALEGYYQD
QVFDQRELHFEIGEGEILDLPCGLEKAIQHMEKGEYSIVYLKPSYAFGSVGKEKFQIPPN
AELKYKVHLKSFEKAKESWEMNSEEKLEQSTIVKERGTVYFKEGKYKQASLQYKKIVSWL
EYESSFLSEEDTQKAQALRLASYLNLAMCQLKLQAFSAAIGSCNKALELDSNNEKGLFRR
GEAHLAVNDFDLARADFQKVLQLYPSNKAAKAQLAICHQRIRKQLALEKKLYAKMFERLA
EEESKAKAVVAAGDYHADTEMKDEQKKDAAGSQSQVETEA
NT seq 1383 nt   +upstreamnt  +downstreamnt
atgaccgccgaggagatgaagggggtcgagagcggggtgcagacggcgccgctgcccatc
gagggagtggacatcagccccaagcaggatgaaggcgtgctgaaggtcatcaagcgagag
ggcacgggcacggagacacccatgattggggaccgagtcgtagttcactacactggctgg
ctgttagatggcaccaagtttgactccagtctggaccacaaggacaaattctgctttgac
ctgggaaaaggggaggtcatcaaggcttgggacattgccgtagcaaccatgaaagtggga
gaagtatgccacatcacctgcaaaccagaatatgcctatggtttggcaggcagccctcca
aagatccctcccaatgccacacttgtgtttgaggtggagttgttcgagttcaagggagaa
gacctgacagaagaagaagatggtggaattatccggagaatacagactcagggtgaaggt
tttgccaagcccaatgatggtgctcttgtggaagttgccctggaaggatactatcaggac
caggtatttgaccagcgggagctccactttgagattggtgagggggagattctggatctg
ccttgtgggctggagaaagccatacagcacatggaaaaaggagaatattccattgtgtac
ctcaagcccagctatgcttttggcagtgttgggaaggaaaagttccaaatcccaccaaat
gctgagctgaaatataaagtccacctcaagagttttgagaaggccaaggagtcttgggag
atgaattcagaggagaagctggaacagagcaccatagtgaaagagcggggcactgtgtac
ttcaaggaaggcaagtacaagcaagcttcactgcaatacaagaagattgtatcctggctg
gagtatgagtcaagtttcttgagtgaggaagacacgcagaaggcacaggcccttcggctg
gcctcttacctcaatctggccatgtgtcagctgaagctacaggctttctcagctgccatt
ggaagctgtaacaaggctctggaactggacagcaacaatgagaaaggccttttccgccga
ggagaggcccacctggcagtgaacgactttgacttggcacgggctgacttccagaaggtc
ctgcagctctaccccagcaacaaagccgccaaggcccagctggctatctgccatcagcgg
attcgcaagcagcttgcactggagaagaagctctatgccaaaatgtttgagaggctagct
gaggaggagagcaaggccaaggcagtagtagctgcaggagactatcatgctgacacagag
atgaaggatgagcagaagaaggatgcggcagggagccagtctcaggtggagacagaagca
tag

DBGET integrated database retrieval system