KEGG   Rousettus aegyptiacus (Egyptian rousette): 107497883
Entry
107497883         CDS       T06036                                 

Gene name
MAPK14
Definition
(RefSeq) mitogen-activated protein kinase 14 isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01522  Endocrine resistance
ray04010  MAPK signaling pathway
ray04015  Rap1 signaling pathway
ray04068  FoxO signaling pathway
ray04071  Sphingolipid signaling pathway
ray04114  Oocyte meiosis
ray04218  Cellular senescence
ray04261  Adrenergic signaling in cardiomyocytes
ray04370  VEGF signaling pathway
ray04380  Osteoclast differentiation
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04611  Platelet activation
ray04613  Neutrophil extracellular trap formation
ray04620  Toll-like receptor signaling pathway
ray04621  NOD-like receptor signaling pathway
ray04622  RIG-I-like receptor signaling pathway
ray04625  C-type lectin receptor signaling pathway
ray04657  IL-17 signaling pathway
ray04658  Th1 and Th2 cell differentiation
ray04659  Th17 cell differentiation
ray04660  T cell receptor signaling pathway
ray04664  Fc epsilon RI signaling pathway
ray04668  TNF signaling pathway
ray04670  Leukocyte transendothelial migration
ray04714  Thermogenesis
ray04722  Neurotrophin signaling pathway
ray04723  Retrograde endocannabinoid signaling
ray04728  Dopaminergic synapse
ray04750  Inflammatory mediator regulation of TRP channels
ray04912  GnRH signaling pathway
ray04914  Progesterone-mediated oocyte maturation
ray04917  Prolactin signaling pathway
ray04926  Relaxin signaling pathway
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray04935  Growth hormone synthesis, secretion and action
ray05014  Amyotrophic lateral sclerosis
ray05020  Prion disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05132  Salmonella infection
ray05133  Pertussis
ray05135  Yersinia infection
ray05140  Leishmaniasis
ray05142  Chagas disease
ray05145  Toxoplasmosis
ray05152  Tuberculosis
ray05161  Hepatitis B
ray05163  Human cytomegalovirus infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05171  Coronavirus disease - COVID-19
ray05205  Proteoglycans in cancer
ray05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107497883 (MAPK14)
   04015 Rap1 signaling pathway
    107497883 (MAPK14)
   04370 VEGF signaling pathway
    107497883 (MAPK14)
   04668 TNF signaling pathway
    107497883 (MAPK14)
   04068 FoxO signaling pathway
    107497883 (MAPK14)
   04071 Sphingolipid signaling pathway
    107497883 (MAPK14)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107497883 (MAPK14)
   04218 Cellular senescence
    107497883 (MAPK14)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107497883 (MAPK14)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107497883 (MAPK14)
   04613 Neutrophil extracellular trap formation
    107497883 (MAPK14)
   04620 Toll-like receptor signaling pathway
    107497883 (MAPK14)
   04621 NOD-like receptor signaling pathway
    107497883 (MAPK14)
   04622 RIG-I-like receptor signaling pathway
    107497883 (MAPK14)
   04625 C-type lectin receptor signaling pathway
    107497883 (MAPK14)
   04660 T cell receptor signaling pathway
    107497883 (MAPK14)
   04658 Th1 and Th2 cell differentiation
    107497883 (MAPK14)
   04659 Th17 cell differentiation
    107497883 (MAPK14)
   04657 IL-17 signaling pathway
    107497883 (MAPK14)
   04664 Fc epsilon RI signaling pathway
    107497883 (MAPK14)
   04670 Leukocyte transendothelial migration
    107497883 (MAPK14)
  09152 Endocrine system
   04912 GnRH signaling pathway
    107497883 (MAPK14)
   04914 Progesterone-mediated oocyte maturation
    107497883 (MAPK14)
   04917 Prolactin signaling pathway
    107497883 (MAPK14)
   04926 Relaxin signaling pathway
    107497883 (MAPK14)
   04935 Growth hormone synthesis, secretion and action
    107497883 (MAPK14)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107497883 (MAPK14)
  09156 Nervous system
   04728 Dopaminergic synapse
    107497883 (MAPK14)
   04723 Retrograde endocannabinoid signaling
    107497883 (MAPK14)
   04722 Neurotrophin signaling pathway
    107497883 (MAPK14)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107497883 (MAPK14)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107497883 (MAPK14)
  09159 Environmental adaptation
   04714 Thermogenesis
    107497883 (MAPK14)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    107497883 (MAPK14)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107497883 (MAPK14)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    107497883 (MAPK14)
   05020 Prion disease
    107497883 (MAPK14)
   05022 Pathways of neurodegeneration - multiple diseases
    107497883 (MAPK14)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107497883 (MAPK14)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107497883 (MAPK14)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107497883 (MAPK14)
   05135 Yersinia infection
    107497883 (MAPK14)
   05133 Pertussis
    107497883 (MAPK14)
   05152 Tuberculosis
    107497883 (MAPK14)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107497883 (MAPK14)
   05161 Hepatitis B
    107497883 (MAPK14)
   05171 Coronavirus disease - COVID-19
    107497883 (MAPK14)
   05163 Human cytomegalovirus infection
    107497883 (MAPK14)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107497883 (MAPK14)
   05169 Epstein-Barr virus infection
    107497883 (MAPK14)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107497883 (MAPK14)
   05140 Leishmaniasis
    107497883 (MAPK14)
   05142 Chagas disease
    107497883 (MAPK14)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107497883 (MAPK14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107497883 (MAPK14)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107497883 (MAPK14)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107497883 (MAPK14)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH NAD_binding_8 Kinase-like
Other DBs
NCBI-GeneID: 107497883
NCBI-ProteinID: XP_015975702
LinkDB
Position
Unknown
AA seq 360 aa
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgtctcaggaaaggcccacgttctaccggcaggagctgaacaagacaatctgggaggtg
ccagagcgttaccagaacctgtctccggtgggctccggcgcctatggctccgtgtgtgct
gcttttgacacaaaaactgggttacgtgtggcagtgaagaagctatccagaccatttcag
tccattattcatgccaaaaggacctacagagaactgcggttacttaaacatatgaaacat
gaaaatgttattggtctgttggatgtttttacacctgcgaggtctctggaggaattcaat
gatgtgtatctggtgacccatctcatgggggcagatctgaacaacattgtgaaatgtcag
aaacttacagatgaccatgttcagttccttatctaccaaattctccgaggtctcaagtat
atacattcagctgacataattcacagggacctaaaacctagtaatctagctgtgaatgaa
gactgtgagctgaagatcctggattttggactggctcgacatacagatgatgaaatgaca
ggctatgtggccactaggtggtacagggctcctgagatcatgctgaactggatgcattac
aaccagacagttgatatttggtcagtgggatgcataatggccgagctgttgactggaaga
acgttgtttcctggtacagaccatattgatcagttgaagctcattttaagactcgttgga
accccaggggctgagcttttgaagaaaatctcctcagagtctgcaagaaactatattcag
tctttgacccagatgccgaagatgaactttgcaaatgtatttattggtgccaatcccttg
gctgtcgacttgctggagaagatgcttgttttggactcagataagagaatcactgcagcc
caggcccttgcacatgcctacttcgcccagtatcatgatcctgatgacgaaccagtggct
gatccttacgatcaatcctttgaaagcagggacctccttatagatgaatggaaaagcctg
acctacgatgaagtcatcagctttgtgccaccaccccttgaccaagaagagatggaatcc
tga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107497895
Entry
107497895         CDS       T06036                                 

Gene name
MAPK13
Definition
(RefSeq) mitogen-activated protein kinase 13
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01522  Endocrine resistance
ray04010  MAPK signaling pathway
ray04015  Rap1 signaling pathway
ray04068  FoxO signaling pathway
ray04071  Sphingolipid signaling pathway
ray04114  Oocyte meiosis
ray04218  Cellular senescence
ray04261  Adrenergic signaling in cardiomyocytes
ray04370  VEGF signaling pathway
ray04380  Osteoclast differentiation
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04611  Platelet activation
ray04613  Neutrophil extracellular trap formation
ray04620  Toll-like receptor signaling pathway
ray04621  NOD-like receptor signaling pathway
ray04622  RIG-I-like receptor signaling pathway
ray04625  C-type lectin receptor signaling pathway
ray04657  IL-17 signaling pathway
ray04658  Th1 and Th2 cell differentiation
ray04659  Th17 cell differentiation
ray04660  T cell receptor signaling pathway
ray04664  Fc epsilon RI signaling pathway
ray04668  TNF signaling pathway
ray04670  Leukocyte transendothelial migration
ray04714  Thermogenesis
ray04722  Neurotrophin signaling pathway
ray04723  Retrograde endocannabinoid signaling
ray04728  Dopaminergic synapse
ray04750  Inflammatory mediator regulation of TRP channels
ray04912  GnRH signaling pathway
ray04914  Progesterone-mediated oocyte maturation
ray04917  Prolactin signaling pathway
ray04926  Relaxin signaling pathway
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray04935  Growth hormone synthesis, secretion and action
ray05014  Amyotrophic lateral sclerosis
ray05020  Prion disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05132  Salmonella infection
ray05133  Pertussis
ray05135  Yersinia infection
ray05140  Leishmaniasis
ray05142  Chagas disease
ray05145  Toxoplasmosis
ray05152  Tuberculosis
ray05161  Hepatitis B
ray05163  Human cytomegalovirus infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05171  Coronavirus disease - COVID-19
ray05205  Proteoglycans in cancer
ray05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107497895 (MAPK13)
   04015 Rap1 signaling pathway
    107497895 (MAPK13)
   04370 VEGF signaling pathway
    107497895 (MAPK13)
   04668 TNF signaling pathway
    107497895 (MAPK13)
   04068 FoxO signaling pathway
    107497895 (MAPK13)
   04071 Sphingolipid signaling pathway
    107497895 (MAPK13)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107497895 (MAPK13)
   04218 Cellular senescence
    107497895 (MAPK13)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107497895 (MAPK13)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107497895 (MAPK13)
   04613 Neutrophil extracellular trap formation
    107497895 (MAPK13)
   04620 Toll-like receptor signaling pathway
    107497895 (MAPK13)
   04621 NOD-like receptor signaling pathway
    107497895 (MAPK13)
   04622 RIG-I-like receptor signaling pathway
    107497895 (MAPK13)
   04625 C-type lectin receptor signaling pathway
    107497895 (MAPK13)
   04660 T cell receptor signaling pathway
    107497895 (MAPK13)
   04658 Th1 and Th2 cell differentiation
    107497895 (MAPK13)
   04659 Th17 cell differentiation
    107497895 (MAPK13)
   04657 IL-17 signaling pathway
    107497895 (MAPK13)
   04664 Fc epsilon RI signaling pathway
    107497895 (MAPK13)
   04670 Leukocyte transendothelial migration
    107497895 (MAPK13)
  09152 Endocrine system
   04912 GnRH signaling pathway
    107497895 (MAPK13)
   04914 Progesterone-mediated oocyte maturation
    107497895 (MAPK13)
   04917 Prolactin signaling pathway
    107497895 (MAPK13)
   04926 Relaxin signaling pathway
    107497895 (MAPK13)
   04935 Growth hormone synthesis, secretion and action
    107497895 (MAPK13)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107497895 (MAPK13)
  09156 Nervous system
   04728 Dopaminergic synapse
    107497895 (MAPK13)
   04723 Retrograde endocannabinoid signaling
    107497895 (MAPK13)
   04722 Neurotrophin signaling pathway
    107497895 (MAPK13)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107497895 (MAPK13)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107497895 (MAPK13)
  09159 Environmental adaptation
   04714 Thermogenesis
    107497895 (MAPK13)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    107497895 (MAPK13)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107497895 (MAPK13)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    107497895 (MAPK13)
   05020 Prion disease
    107497895 (MAPK13)
   05022 Pathways of neurodegeneration - multiple diseases
    107497895 (MAPK13)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107497895 (MAPK13)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107497895 (MAPK13)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107497895 (MAPK13)
   05135 Yersinia infection
    107497895 (MAPK13)
   05133 Pertussis
    107497895 (MAPK13)
   05152 Tuberculosis
    107497895 (MAPK13)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107497895 (MAPK13)
   05161 Hepatitis B
    107497895 (MAPK13)
   05171 Coronavirus disease - COVID-19
    107497895 (MAPK13)
   05163 Human cytomegalovirus infection
    107497895 (MAPK13)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107497895 (MAPK13)
   05169 Epstein-Barr virus infection
    107497895 (MAPK13)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107497895 (MAPK13)
   05140 Leishmaniasis
    107497895 (MAPK13)
   05142 Chagas disease
    107497895 (MAPK13)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107497895 (MAPK13)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107497895 (MAPK13)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107497895 (MAPK13)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107497895 (MAPK13)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH RIO1 Kinase-like Kdo DUF4023
Other DBs
NCBI-GeneID: 107497895
NCBI-ProteinID: XP_015975732
LinkDB
Position
Unknown
AA seq 365 aa
MSFTRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGAVCSAIDKRSGEKVAIKKLSRPF
QSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRSFHDFYLVMPFMQTDLQKIMGM
EFSEDKIQYLVYQMLKGLKYIHSAGVIHRDLKPGNLAVNEDCELKILDFGLARHADAEMT
GYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFRGKDYLDQLTQILKVTG
VPGTEFVQKLNDKAAKSYIQSLPQSPKKDFSQLFPRASPQAVDLLEKMLELDVDKRLTAS
QALAHPFFEPFRDPEEETEAQKFDDSLEHEKLTVDEWKQHIYKEIVSFSPIARKDSRRRS
GMKLQ
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgagcttcacccggaaaaagggcttctacaagcaggacgtcaacaagaccgcctgggag
ctgcccaagacctacgtgtccccgacccacgtcggcagcggggcctatggcgcggtgtgt
tctgccatcgacaagcggtcaggggagaaggtggccatcaagaagctgagccggcccttc
cagtctgagatctttgcgaagcgggcctatcgagagctgctgctgctgaaacacatgcag
catgagaacgtcattgggctcctggatgtcttcaccccagcctcctccctgcgcagcttc
catgacttctacctggtgatgcccttcatgcagacagacctgcagaagatcatggggatg
gagttcagtgaggacaagatccagtacctggtgtatcagatgctcaaaggtcttaagtac
atccactccgctggagtcatccacagggacctgaagccaggcaaccttgctgtgaacgag
gactgtgagctgaagatcttggattttgggctggcacggcatgcagatgctgagatgact
ggctatgtggtgactcgctggtaccgggcccctgaggtgatactcagctggatgcactac
aaccagactgtggacatctggtctgtgggctgcatcatggcagagatgctgactgggaaa
actctgttcagggggaaagactacctggaccagttgacccagatcctgaaagtgactggg
gtgccgggcacagaatttgtgcagaaattgaacgacaaagcggccaaatcctacatccag
tccctgccacagagccccaagaaggatttctcccagctcttcccccgcgccagcccccag
gccgtagacctgctggagaagatgctggagctggacgtggacaagcgcctaacagcctca
caggccctcgcccaccccttctttgaacccttccgagaccctgaagaggaaacagaggcc
cagaagtttgatgactccttagaacatgagaaactcacagtggacgaatggaagcagcac
atctacaaggagattgtgagcttcagccccattgcccggaaggactcgcggcgccgaagt
ggcatgaagctgcaatga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107500264
Entry
107500264         CDS       T06036                                 

Gene name
MAPK12
Definition
(RefSeq) mitogen-activated protein kinase 12 isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01522  Endocrine resistance
ray04010  MAPK signaling pathway
ray04015  Rap1 signaling pathway
ray04068  FoxO signaling pathway
ray04071  Sphingolipid signaling pathway
ray04114  Oocyte meiosis
ray04218  Cellular senescence
ray04261  Adrenergic signaling in cardiomyocytes
ray04370  VEGF signaling pathway
ray04380  Osteoclast differentiation
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04611  Platelet activation
ray04613  Neutrophil extracellular trap formation
ray04620  Toll-like receptor signaling pathway
ray04621  NOD-like receptor signaling pathway
ray04622  RIG-I-like receptor signaling pathway
ray04625  C-type lectin receptor signaling pathway
ray04657  IL-17 signaling pathway
ray04658  Th1 and Th2 cell differentiation
ray04659  Th17 cell differentiation
ray04660  T cell receptor signaling pathway
ray04664  Fc epsilon RI signaling pathway
ray04668  TNF signaling pathway
ray04670  Leukocyte transendothelial migration
ray04714  Thermogenesis
ray04722  Neurotrophin signaling pathway
ray04723  Retrograde endocannabinoid signaling
ray04728  Dopaminergic synapse
ray04750  Inflammatory mediator regulation of TRP channels
ray04912  GnRH signaling pathway
ray04914  Progesterone-mediated oocyte maturation
ray04917  Prolactin signaling pathway
ray04926  Relaxin signaling pathway
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray04935  Growth hormone synthesis, secretion and action
ray05014  Amyotrophic lateral sclerosis
ray05020  Prion disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05132  Salmonella infection
ray05133  Pertussis
ray05135  Yersinia infection
ray05140  Leishmaniasis
ray05142  Chagas disease
ray05145  Toxoplasmosis
ray05152  Tuberculosis
ray05161  Hepatitis B
ray05163  Human cytomegalovirus infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05171  Coronavirus disease - COVID-19
ray05205  Proteoglycans in cancer
ray05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107500264 (MAPK12)
   04015 Rap1 signaling pathway
    107500264 (MAPK12)
   04370 VEGF signaling pathway
    107500264 (MAPK12)
   04668 TNF signaling pathway
    107500264 (MAPK12)
   04068 FoxO signaling pathway
    107500264 (MAPK12)
   04071 Sphingolipid signaling pathway
    107500264 (MAPK12)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107500264 (MAPK12)
   04218 Cellular senescence
    107500264 (MAPK12)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107500264 (MAPK12)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107500264 (MAPK12)
   04613 Neutrophil extracellular trap formation
    107500264 (MAPK12)
   04620 Toll-like receptor signaling pathway
    107500264 (MAPK12)
   04621 NOD-like receptor signaling pathway
    107500264 (MAPK12)
   04622 RIG-I-like receptor signaling pathway
    107500264 (MAPK12)
   04625 C-type lectin receptor signaling pathway
    107500264 (MAPK12)
   04660 T cell receptor signaling pathway
    107500264 (MAPK12)
   04658 Th1 and Th2 cell differentiation
    107500264 (MAPK12)
   04659 Th17 cell differentiation
    107500264 (MAPK12)
   04657 IL-17 signaling pathway
    107500264 (MAPK12)
   04664 Fc epsilon RI signaling pathway
    107500264 (MAPK12)
   04670 Leukocyte transendothelial migration
    107500264 (MAPK12)
  09152 Endocrine system
   04912 GnRH signaling pathway
    107500264 (MAPK12)
   04914 Progesterone-mediated oocyte maturation
    107500264 (MAPK12)
   04917 Prolactin signaling pathway
    107500264 (MAPK12)
   04926 Relaxin signaling pathway
    107500264 (MAPK12)
   04935 Growth hormone synthesis, secretion and action
    107500264 (MAPK12)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107500264 (MAPK12)
  09156 Nervous system
   04728 Dopaminergic synapse
    107500264 (MAPK12)
   04723 Retrograde endocannabinoid signaling
    107500264 (MAPK12)
   04722 Neurotrophin signaling pathway
    107500264 (MAPK12)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107500264 (MAPK12)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107500264 (MAPK12)
  09159 Environmental adaptation
   04714 Thermogenesis
    107500264 (MAPK12)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    107500264 (MAPK12)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107500264 (MAPK12)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    107500264 (MAPK12)
   05020 Prion disease
    107500264 (MAPK12)
   05022 Pathways of neurodegeneration - multiple diseases
    107500264 (MAPK12)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107500264 (MAPK12)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107500264 (MAPK12)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107500264 (MAPK12)
   05135 Yersinia infection
    107500264 (MAPK12)
   05133 Pertussis
    107500264 (MAPK12)
   05152 Tuberculosis
    107500264 (MAPK12)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107500264 (MAPK12)
   05161 Hepatitis B
    107500264 (MAPK12)
   05171 Coronavirus disease - COVID-19
    107500264 (MAPK12)
   05163 Human cytomegalovirus infection
    107500264 (MAPK12)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107500264 (MAPK12)
   05169 Epstein-Barr virus infection
    107500264 (MAPK12)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107500264 (MAPK12)
   05140 Leishmaniasis
    107500264 (MAPK12)
   05142 Chagas disease
    107500264 (MAPK12)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107500264 (MAPK12)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107500264 (MAPK12)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107500264 (MAPK12)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107500264 (MAPK12)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like
Other DBs
NCBI-GeneID: 107500264
NCBI-ProteinID: XP_015980806
LinkDB
Position
Unknown
AA seq 382 aa
MSSPPPARKGFYRQEVTKTSWEVRAVYQDLQPVGSGAYGAVCSAVDSRTGAKVAIKKLYR
PFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLM
KHEKLSEDRIQFLVYQMLKGLKYIHAAGVIHRDLKPGNLAVNEDCELKILDFGLARQADS
EMTGYVVTRWYRAPEVILNWMHYTQTVDVWSAGCIMAEMITGKTLFKGNDHLDQLKEILK
VTGTPPDEFVQRLQSADAKDYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAERRV
TAAEALTHPYFESLHDTEDEPEAQKYDESFDDVDRTLDEWKREWDVGRACGWPSNPCRWP
CSESRPPGEERNGRSDAVGLPG
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgagctctccgccgcccgcccgcaagggcttttaccgccaggaggtgaccaagacgtcc
tgggaggtgcgcgccgtgtaccaggacctgcagcccgtgggctcgggcgcctatggcgcc
gtctgctcggccgtggacagccgcacaggcgccaaagtggccatcaagaagctgtaccgg
cccttccagtcggagctgttcgccaagcgcgcctaccgcgagctgcgcctcctcaagcac
atgcgtcacgagaatgtgatcgggctgctggacgtgttcactcctgatgagaccctggac
gatttcacagacttctacctggtcatgccgttcatgggcacggacctgggcaagctcatg
aagcacgagaagctgagcgaggaccggatccagttcctcgtctaccagatgctgaagggg
ctgaagtacatccacgcagctggtgtcatccacagggacctgaagcctggcaatctggcg
gtgaacgaggactgtgagctgaagatcctggacttcggcctagccaggcaggcagacagc
gagatgactggatacgtggtgacccggtggtaccgggcgcccgaggtcatcttgaattgg
atgcactatacacagacggtggacgtctggtcagcaggctgcatcatggcagagatgatc
acagggaagacgctgttcaagggcaatgaccacctggaccagctgaaggagatcttgaag
gtgacggggacaccgccggatgagttcgtgcagaggctgcagagcgctgacgccaaggac
tacatgaagggcctgcccgagctggagaagaaggattttgcctccatcctgaccaacgca
agccctctggctgtgaacctcctggagaaaatgctggtgctggatgcggagcggcgggtg
acggcagccgaggcgctcacccacccctacttcgagtcactgcacgacacggaggatgag
cccgaggcccagaaatatgacgagtcctttgatgatgtggaccgcacgctggacgagtgg
aagcgtgagtgggatgtgggcagggcctgtggctggccctcgaacccctgcaggtggcca
tgctcagagtcgcgtcccccgggggaggaacgcaatgggaggtcagatgctgtggggctt
cccggctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107500274
Entry
107500274         CDS       T06036                                 

Gene name
MAPK11
Definition
(RefSeq) mitogen-activated protein kinase 11 isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01522  Endocrine resistance
ray04010  MAPK signaling pathway
ray04015  Rap1 signaling pathway
ray04068  FoxO signaling pathway
ray04071  Sphingolipid signaling pathway
ray04114  Oocyte meiosis
ray04218  Cellular senescence
ray04261  Adrenergic signaling in cardiomyocytes
ray04370  VEGF signaling pathway
ray04380  Osteoclast differentiation
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04611  Platelet activation
ray04613  Neutrophil extracellular trap formation
ray04620  Toll-like receptor signaling pathway
ray04621  NOD-like receptor signaling pathway
ray04622  RIG-I-like receptor signaling pathway
ray04625  C-type lectin receptor signaling pathway
ray04657  IL-17 signaling pathway
ray04658  Th1 and Th2 cell differentiation
ray04659  Th17 cell differentiation
ray04660  T cell receptor signaling pathway
ray04664  Fc epsilon RI signaling pathway
ray04668  TNF signaling pathway
ray04670  Leukocyte transendothelial migration
ray04714  Thermogenesis
ray04722  Neurotrophin signaling pathway
ray04723  Retrograde endocannabinoid signaling
ray04728  Dopaminergic synapse
ray04750  Inflammatory mediator regulation of TRP channels
ray04912  GnRH signaling pathway
ray04914  Progesterone-mediated oocyte maturation
ray04917  Prolactin signaling pathway
ray04926  Relaxin signaling pathway
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray04935  Growth hormone synthesis, secretion and action
ray05014  Amyotrophic lateral sclerosis
ray05020  Prion disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05132  Salmonella infection
ray05133  Pertussis
ray05135  Yersinia infection
ray05140  Leishmaniasis
ray05142  Chagas disease
ray05145  Toxoplasmosis
ray05152  Tuberculosis
ray05161  Hepatitis B
ray05163  Human cytomegalovirus infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05171  Coronavirus disease - COVID-19
ray05205  Proteoglycans in cancer
ray05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107500274 (MAPK11)
   04015 Rap1 signaling pathway
    107500274 (MAPK11)
   04370 VEGF signaling pathway
    107500274 (MAPK11)
   04668 TNF signaling pathway
    107500274 (MAPK11)
   04068 FoxO signaling pathway
    107500274 (MAPK11)
   04071 Sphingolipid signaling pathway
    107500274 (MAPK11)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107500274 (MAPK11)
   04218 Cellular senescence
    107500274 (MAPK11)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107500274 (MAPK11)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107500274 (MAPK11)
   04613 Neutrophil extracellular trap formation
    107500274 (MAPK11)
   04620 Toll-like receptor signaling pathway
    107500274 (MAPK11)
   04621 NOD-like receptor signaling pathway
    107500274 (MAPK11)
   04622 RIG-I-like receptor signaling pathway
    107500274 (MAPK11)
   04625 C-type lectin receptor signaling pathway
    107500274 (MAPK11)
   04660 T cell receptor signaling pathway
    107500274 (MAPK11)
   04658 Th1 and Th2 cell differentiation
    107500274 (MAPK11)
   04659 Th17 cell differentiation
    107500274 (MAPK11)
   04657 IL-17 signaling pathway
    107500274 (MAPK11)
   04664 Fc epsilon RI signaling pathway
    107500274 (MAPK11)
   04670 Leukocyte transendothelial migration
    107500274 (MAPK11)
  09152 Endocrine system
   04912 GnRH signaling pathway
    107500274 (MAPK11)
   04914 Progesterone-mediated oocyte maturation
    107500274 (MAPK11)
   04917 Prolactin signaling pathway
    107500274 (MAPK11)
   04926 Relaxin signaling pathway
    107500274 (MAPK11)
   04935 Growth hormone synthesis, secretion and action
    107500274 (MAPK11)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107500274 (MAPK11)
  09156 Nervous system
   04728 Dopaminergic synapse
    107500274 (MAPK11)
   04723 Retrograde endocannabinoid signaling
    107500274 (MAPK11)
   04722 Neurotrophin signaling pathway
    107500274 (MAPK11)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107500274 (MAPK11)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107500274 (MAPK11)
  09159 Environmental adaptation
   04714 Thermogenesis
    107500274 (MAPK11)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    107500274 (MAPK11)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107500274 (MAPK11)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    107500274 (MAPK11)
   05020 Prion disease
    107500274 (MAPK11)
   05022 Pathways of neurodegeneration - multiple diseases
    107500274 (MAPK11)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107500274 (MAPK11)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107500274 (MAPK11)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107500274 (MAPK11)
   05135 Yersinia infection
    107500274 (MAPK11)
   05133 Pertussis
    107500274 (MAPK11)
   05152 Tuberculosis
    107500274 (MAPK11)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107500274 (MAPK11)
   05161 Hepatitis B
    107500274 (MAPK11)
   05171 Coronavirus disease - COVID-19
    107500274 (MAPK11)
   05163 Human cytomegalovirus infection
    107500274 (MAPK11)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107500274 (MAPK11)
   05169 Epstein-Barr virus infection
    107500274 (MAPK11)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107500274 (MAPK11)
   05140 Leishmaniasis
    107500274 (MAPK11)
   05142 Chagas disease
    107500274 (MAPK11)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107500274 (MAPK11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107500274 (MAPK11)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107500274 (MAPK11)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107500274 (MAPK11)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH RIO1
Other DBs
NCBI-GeneID: 107500274
NCBI-ProteinID: XP_015980832
LinkDB
Position
Unknown
AA seq 647 aa
MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDTRLRQKVAVKKLSRPFQ
SLIHARRTYRELRLLKHLKHENVIGLLDVFTPAASIEDFSEVYLVTTLMGADLNNIVKCQ
ALTDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGGDYIDQLKRIMEVVG
TPSPEVLAKMTSEHARTYVQSLPPVPQKDLRSIFRGANPLAVDLLGRMLVLDSDQRVSAA
EALGHAYFSQYHDPDDEPEAEPYDDSVESSPTRKCSASSPQSHRSRLSAWRSGSEGDAAG
QPHENLRRGLSLPVPSSACRVPMRGSRSPLPGTPGPHATLRGSLCTPVNARPHAPVQAMG
TGAWAECPGPPQSSCSLLVSLETSLGTWMPRGPSGECVCLQVSLVPGGCLGAAHQSQGPL
ETQREGCQGSELLWEMLRSEGLGAGQGLLREVAGWRQPPRVGPANAPGATSSALCGTRAP
GCVPAVCMSRRVQACVCGRPRWAGYTCLPSPRFWCHGGAEILLGTTSGAQVDRESAREPR
PGTPLGFQRCGGAVPAGALAHGGLGGTQRAGTHRCGPGLGLWALAPS
NT seq 1944 nt   +upstreamnt  +downstreamnt
atgtcgggcccgcgcgcgggcttctaccggcaggagctgaacaagacggtgtgggaggtg
ccgcagcggctgcaggggctgcgcccggtgggctccggcgcctacggctccgtctgctcg
gcctacgacacgcggctgcgccagaaggtggcggtgaagaagctgtcgcgcccctttcag
tcgctgatccatgcgcggaggacctaccgggagctgcggctgctcaaacacctgaagcac
gagaacgtcatcgggctgctggacgtcttcacccccgccgcctccatcgaggacttcagc
gaagtgtacctggtgaccactctgatgggcgcagacctgaacaacatcgtcaagtgccag
gcgctgaccgacgagcacgtccagttcctcgtgtaccagctgctgcgcgggctgaagtac
atccactcggccgggatcatccaccgggacctgaagcccagcaacgtggcggtgaacgag
gactgcgagctcaggatcctggacttcggtctggcgcgccaggccgatgaggagatgacg
ggctacgtggccacacgctggtaccgcgcgccggagataatgctcaactggatgcactac
aaccagacagtggacatctggtctgtgggctgcatcatggccgagctgctgcagggaaag
gctctcttcccaggaggggactacatcgaccagctgaagcgcatcatggaggtggtgggc
acacccagccctgaagtcctggcaaagatgacctcggaacatgcccggacgtacgtccag
tccctgcctcccgtgccccagaaggacctcaggagcatcttccgcggcgccaaccccctg
gctgtggaccttctgggacggatgctagtgctggacagtgaccagagggttagtgcggcc
gaggccctgggccacgcctacttcagccagtaccacgacccggatgatgagcccgaggct
gagccctacgatgacagcgtggagagctcacctaccaggaagtgctcagcttcaagcccc
cagagccaccgcagccgcctgtcagcctggagatcgggcagtgagggggatgctgctggc
cagccacacgagaacttgaggaggggcctcagcctgcctgtcccttcctcagcctgccgg
gttcccatgaggggcagccgcagccccctgcctgggacccctggtccgcatgccactctt
cgtgggagcctgtgcacacctgtgaatgcacgaccgcatgcacctgtgcaagccatgggc
acaggagcctgggcagagtgtcctggaccgcctcagtcctcctgttccctcctggtctcc
ctcgagacctcgctggggacctggatgcctaggggtccctctggggagtgtgtctgtctc
caggtctccttagtcccaggaggctgtctaggggcagcgcatcagagccagggccccctg
gaaactcaaagggaggggtgtcaggggtcagagctgctctgggagatgctgagatctgaa
ggccttggagctgggcagggtcttctccgtgaggtggcagggtggagacagccaccgagg
gtcggaccggcaaatgcacctggagccacgagttctgcgctgtgtggcacgcgtgcccca
gggtgtgttcctgccgtttgcatgtcaaggcgtgtgcaggcgtgtgtctgtggaaggccc
aggtgggctggctatacttgcctcccctctccccgcttctggtgccatgggggtgccgag
atcctgctgggcaccacatcaggggctcaggtggacagagaatcagcacgcgagcctcgg
ccgggcactccccttggttttcagagatgtgggggtgcagtgccagccggggcgctggca
cacggggggctggggggcactcagagggctggcacacaccgatgtggacctggactcgga
ctctgggccttggccccgagctga

DBGET integrated database retrieval system