KEGG   Rousettus aegyptiacus (Egyptian rousette): 107497976
Entry
107497976         CDS       T06036                                 

Gene name
IL25
Definition
(RefSeq) interleukin-25
  KO
K05493  interleukin 17E
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04060  Cytokine-cytokine receptor interaction
ray04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107497976 (IL25)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    107497976 (IL25)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107497976 (IL25)
Cytokines and growth factors [BR:ray04052]
 Cytokines
  Interleukins
   107497976 (IL25)
SSDB
Motif
Pfam: IL17
Other DBs
NCBI-GeneID: 107497976
NCBI-ProteinID: XP_015975960
LinkDB
Position
Unknown
AA seq 169 aa
MYQVVAFLAVVMGTHTLSWPLQKDRTRWPSCCLSKGQDPTEEWLKWNTVLMPSSEIASFT
RHPESCRASEDGPLNSRSISPWSYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPLG
NSELLYHNQTVFYRRPCPGEQGAHHGYCLERRLYRVSLACVCVRPRVMA
NT seq 510 nt   +upstreamnt  +downstreamnt
atgtaccaggtggttgccttcttagcagtagtcatgggaacccacaccctcagttggcca
cttcagaaggaccgtacccgctggcccagctgctgcctcagcaaaggtcaggaccccact
gaggagtggctgaagtggaacactgtgctcatgccttcctcagagattgctagcttcacc
cgccatccagaatcctgcagggccagcgaagacggacccctcaacagcaggtccatctcc
ccctggagttacgagttggacagggacttgaaccggctcccccaggacctgtaccacgcc
cgttgcctgtgtccacactgcgtcagcctacagacaggttcccacatggaccccctgggc
aactcggagctgctctaccacaaccagactgtcttctatcggaggccgtgcccgggagaa
cagggtgcccatcatggctactgcttggaacgcaggctctaccgcgtctccttggcttgc
gtgtgtgtgcggccccgtgtgatggcctag

DBGET integrated database retrieval system