KEGG   Rousettus aegyptiacus (Egyptian rousette): 107498008
Entry
107498008         CDS       T06036                                 

Gene name
REC8
Definition
(RefSeq) meiotic recombination protein REC8 homolog isoform X1
  KO
K13054  meiotic recombination protein REC8, animal type
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04114  Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107498008 (REC8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ray03036]
    107498008 (REC8)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Meiosis-specific sister chromatid cohesion proteins
   Cohesin complex
    107498008 (REC8)
SSDB
Motif
Pfam: Rad21_Rec8_N Rad21_Rec8 SMC_ScpA
Other DBs
NCBI-GeneID: 107498008
NCBI-ProteinID: XP_015976033
LinkDB
Position
Unknown
AA seq 583 aa
MFYYPNVLQRHTGCFATIWLAATRGSRLVKREYLKVNVVKTCEEILNYLLVRVQPPQPGL
PRPRFSLYLSAQLQIGVIRVYSQQCQYLVEDIQHILERLHRVQLQIRIDMVETDLPSLLL
PNHLALMETLEDAPDPFFGIMSVGPRLPSPFNIPQIRHLLEAVTPERVPEEAPPEVPTEP
GKPVRPLVTVISPEAITLQEAEPIRMLEIEGERDLPEVSRRDLDLLIAEEDEAILLEERV
SKEEPRAPEMEITVPPLSPIALAQVEVAAEPLPGPVLAPEELKPAVWEPEALLAEVTPPE
ELRLPAPLSPERRPPISPPARRRRRRRQLLFWDKETQISREQFQKQLYTRAHCWECPMVQ
PPERTIRSPTELFQTPTYSGWLSPELLALWTHCAQPPPRALRRMPPLEPEEEEAAEREAA
AEEERRKAETPSDIEVLREAQEPSGPLMLSSELSIETAEEEKSRISLIPPEERWVWAEAE
QPEPPALPVVPELPEVPMEIPLELPPEPELLSLEAVHRAVALELQANREPDFNSLVSPLS
PRRVAARVFYLLLVLAMQQILRIEQEKPYGRLLIQPGPRFHSS
NT seq 1752 nt   +upstreamnt  +downstreamnt
atgttctactatcccaacgtgcttcagcgccacaccggctgcttcgccaccatctggctg
gcagcgacccgcggcagccggttggtgaagcgagaatacctgaaagttaatgtggtcaag
acctgtgaggaaatcctcaattacctgctggtacgagtgcaacctccccagcccggcctg
ccgaggccccgcttctccctctatctctcagcccagctccagattggcgtgatccgggtc
tactcacaacaatgccagtacctcgtagaggacatccagcacatcctggagcgtctgcac
cgtgttcagctgcagatccgaatagatatggtggagactgacctaccgagcctgctgctt
cctaaccacctggctttgatggagaccctggaagatgctccagaccccttttttgggata
atgtctgtgggacctagacttcctagccccttcaatatccctcagattcgacaccttttg
gaggctgtgactccagagagagttcctgaggaggcccctcctgaagtccccacagagcct
gggaaaccagtcaggcccctggtcactgtaatatctcctgaggccatcaccctccaggaa
gcggagcccatacgcatgctagagattgagggtgaacgggatctcccagaggttagccgc
cgagacttggacctgctcattgcagaggaagatgaagcaatcttgttggaggaacgagtg
tccaaggaggagccccgagccccggaaatggaaattacagttcccccgctctcacctata
gctcttgcacaggtggaagtggcagcagaaccacttccaggcccagtcctggcccctgag
gagctgaagccagcagtctgggagcctgaggccctgcttgctgaggtgacgcccccagag
gagctccgtctcccggccccactcagcccagagaggaggcccccaatttcaccacctgct
cgtcgccgccgccgccgccgccagttattgttctgggacaaggagactcagatctcccgg
gagcaattccagaaacagctgtacaccagagctcactgctgggagtgtccaatggtgcag
cctcctgagaggaccatcagaagccccacagagctgttccaaaccccaacttactctggc
tggctatccccagaactgctggctctctggacccactgtgcccagccacccccaagagca
ctcaggcgaatgccacccctggagcctgaggaggaggaggctgctgagagagaagcagca
gctgaagaggaaaggagaaaggctgaaactccgagtgatattgaggtcctgagggaggcc
caagagcccagtgggcccctcatgctgtcttcagagctctccatagaaacagctgaggag
gagaaatcccgcatcagcctcattcccccagaagagcggtgggtctgggctgaggcagag
cagccagaaccccctgcattgcctgtggtgcctgaactccccgaggtgcccatggaaata
cctttggagctgcccccagagcccgagctactctcacttgaagctgtgcacagggcagtg
gcactggagctgcaggccaacagggagccagatttcaacagcctggtgtcacctctcagt
ccccgcagggtggctgcccgggtcttctacctgctcctagtgctcgcgatgcagcagatc
cttcgcatagaacaagagaagccatacgggcgtctcctgattcagccagggccacgattc
cacagcagttag

DBGET integrated database retrieval system