KEGG   Rousettus aegyptiacus (Egyptian rousette): 107498010
Entry
107498010         CDS       T06036                                 

Gene name
MYH6
Definition
(RefSeq) myosin-6
  KO
K17751  myosin heavy chain 6/7
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04022  cGMP-PKG signaling pathway
ray04260  Cardiac muscle contraction
ray04261  Adrenergic signaling in cardiomyocytes
ray04919  Thyroid hormone signaling pathway
ray05410  Hypertrophic cardiomyopathy
ray05414  Dilated cardiomyopathy
ray05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    107498010 (MYH6)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    107498010 (MYH6)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107498010 (MYH6)
   04261 Adrenergic signaling in cardiomyocytes
    107498010 (MYH6)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107498010 (MYH6)
   05414 Dilated cardiomyopathy
    107498010 (MYH6)
   05416 Viral myocarditis
    107498010 (MYH6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107498010 (MYH6)
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     107498010 (MYH6)
SSDB
Motif
Pfam: Myosin_head Myosin_tail_1 Myosin_N Filament Crescentin IQ AAA_22
Other DBs
NCBI-GeneID: 107498010
NCBI-ProteinID: XP_015976036
LinkDB
Position
Unknown
AA seq 1939 aa
MTDAQMADFGAAAQYLRKSEKERLEAQTRPFDIRTECFVPDDKEEFVKAKIVSREGGKVT
AETENGKTVTLKEDQVLQQNPPKFDKIEDMAMLTFLHEPAVLFNLKERYAAWMIYTYSGL
FCVTVNPYKWLPVYNAEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGES
GAGKTVNTKRVIQYFASIAAIGDRGKKDNANANKGTLEDQIIQANPALEAFGNAKTVRND
NSSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERNYHIFYQILSNKKPDLLD
MLLVTNNPYDYAFVSQGEVSVASIDDSEELMATDSAFDVLGFTPEEKAGVYKLTGAIMHY
GNMKFKQKQREEQAEPDGTEDADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQSVQQ
VYYSIGALAKAVYEKMFNWMVTRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCIN
FTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLQACIDLIEKPMGIMSILEEECM
FPKATDMTFKSKLYDNHLGKSNNFQKPRNVKGKQEAHFSLVHYAGTVDYNILGWLEKNKD
PLNETVVGLYQKSSLKLMATLFSSYASADTGDSGKGKGGKKKGSSFQTVSALHRENLNKL
MTNLKTTHPHFVRCIIPNERKAPGVMDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDF
RQRYRILNPAAIPEGQFIDSRKGAEKLLGSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRD
ERLSRIITRIQAQARGQLMRIEFKKIVERRDALLVIQWNIRAFMGVKNWPWMKLYFKIKP
LLKSAETEKEMANMKEEFGRIKETLEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNL
NDAEERCDQLIKNKIQLEAKVKEMNERLEDEEEMNAELTAKKRKLEDECSELKKDIDDLE
LTLAKVEKEKHATENKVKNLTEEMAGLDEIIAKLTKEKKALQEAHQQALDDLQAEEDKVN
TLTKSKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKLQLEE
KLKKKEFDISQQNSKIEDEQALALQLQKKLKENQARIEELEEELEAERTARAKVEKLRSD
LSRELEEISERLEEAGGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHAD
SVAELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKVSRTLEDQANE
YRTKLEEAQRSLNDFTTQRAKLQTENGELARQLEEKEALISQLTRGKLSYTQQMEDLKRQ
LEEEGKAKNALAHALQSARHDCDLLREQYEEETEAKAELQRVLSKANSEVAQWRTKYETD
AIQRTEELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAA
AAALDKKQRNFDKILAEWKQKYEESQSELESSQKEARSLSTELFKLKNAYEESLEHLETY
KRENKNLQEEISDLTEQLGEGGKNVHELEKVRKQLEVEKLELQSALEEAEASLEHEEGKI
LRAQLEFNQIKAEIERKLAEKDEEMEQAKRNHLRVVDSLQTSLDAETRSRNEALRVKKKM
EGDLNEMEIQLSQANRTASEAQKHLKIAQAHLKDTQLQMDDAVRANDDLKENIAIVERRN
NLLQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMESDLTQLQ
SEVEEAVQECKNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLD
EAEQIALKGGKKQLQKLEARVRELENELEAEQKRNVESVKGMRKSERRIKELTYQTEEDK
KNLLRLQDLVDKLQLKVKAYKRQAEEAEEQANTNLSKFRKVQHELDEAEERADIAESQVN
KLRAKSRDIGAKQKMHDEE
NT seq 5820 nt   +upstreamnt  +downstreamnt
atgactgatgcccagatggccgattttggggcggcagcccagtacctccgcaagtcagag
aaggagcgtctagaggcccaaacccggcccttcgacatccgcactgagtgctttgtgcct
gatgacaaggaggagttcgtcaaggccaagatcgtatcccgggaagggggcaaggtcact
gccgagactgagaatggcaagacagtgaccttgaaggaagaccaggtgttgcagcagaac
ccgcccaagttcgacaagattgaggacatggccatgctgaccttcctgcatgagcccgcg
gtgctcttcaacctcaaggagcgctacgcggcctggatgatctacacctactcaggcctc
ttctgcgtcaccgtcaacccctacaagtggctgccagtgtacaatgctgaggtggtggcc
gcctaccggggcaagaagaggagtgaggccccaccccacatcttctccatctccgacaac
gcctatcagtacatgctgacagatcgggagaaccagtccatcctcatcaccggagaatct
ggggcagggaagactgtgaacacgaaacgtgtcatccagtattttgccagcattgcagcc
ataggcgaccgtggcaagaaggacaatgccaatgctaacaagggcaccctggaggaccag
atcatccaggccaaccccgccttggaggccttcggcaatgccaagaccgtcaggaatgac
aactcctcccgcttcgggaaattcatcaggatccactttggagccactggaaagttggct
tctgcagacatagagacctatctcctggagaagtcacgggtgatcttccagctcaaggct
gagaggaactaccacatcttctaccagatcctgtccaacaagaagccagacctactggat
atgctgctggtcaccaacaacccctatgactacgccttcgtgtctcagggagaggtgtcc
gtggcctccatcgacgactctgaggagctcatggccacagatagcgcctttgacgtgctg
ggtttcactcctgaggagaaagcgggcgtctacaagctgacaggtgccatcatgcactat
gggaacatgaagttcaagcagaagcagcgggaagagcaggccgagcctgacggcaccgaa
gatgccgacaagtctgcctacctcatggggctgaactcagcagacctgctcaaagggttg
tgccaccctcgggtgaaagtgggtaacgagtacgtcaccaaggggcagagcgtgcagcag
gtgtactattccattggggcgctggccaaagcagtgtacgagaagatgttcaactggatg
gtgacgaggatcaacgccactctggagaccaagcagccgcgccagtacttcattggagtc
ctggacatcgctggcttcgagatctttgacttcaacagcttcgagcagctctgcatcaac
tttaccaacgagaagctgcagcagttcttcaaccaccacatgttcgtgctggagcaggag
gagtacaagaaggagggcatcgagtgggagttcattgactttggcatggacctgcaggcc
tgcatcgacctcatcgagaagcccatgggcatcatgtccatcctggaggaggagtgcatg
ttccccaaggccactgacatgacgttcaagtctaagctgtacgacaaccacctgggcaag
tccaacaacttccagaagccgcgcaacgtcaaggggaagcaggaggcccacttctccttg
gtccactacgctggcaccgtggactacaacatcctgggctggctggagaagaacaaagac
ccgctgaacgagacggtggtgggcctgtaccagaagtcctccctcaagctcatggccaca
ctcttctcctcatatgcttccgctgataccggggacagcggtaaaggcaaaggaggcaag
aaaaagggctcatcctttcagacggtgtcggccctccaccgggagaatctgaacaagcta
atgactaacctgaagactactcaccctcacttcgtgcgctgcatcatccccaatgaacgg
aaggctccaggggtgatggacaaccccctggtcatgcaccagctgcgctgcaacggcgtg
ctggagggcattcgcatctgcaggaagggcttccccaaccgcatcctctacggcgacttc
cggcagaggtatcgcatcctgaacccagcggccatccccgaagggcagttcatcgacagc
aggaaaggggcagagaagctgctgggctccctggacattgaccacaaccagtacaagttc
ggccacaccaaggtgttcttcaaggcggggctgctggggctgctggaggagatgcgagat
gagaggctgagccgcatcatcacccgcatccaggcccaggcccggggccagctcatgcgc
attgagttcaagaagattgtggagcgcagggacgccctgctggtaatccagtggaacatt
cgggccttcatgggagtcaagaactggccctggatgaagctctacttcaagatcaagccg
ctgctgaagagcgcagagacggagaaggagatggccaacatgaaggaggagtttgggcgc
atcaaagagacgctggagaagtccgaggctcgccgcaaggagctggaggagaagatggta
tccttgctgcaggagaagaatgacctacagctccaagtgcaggcggaacaagacaacctc
aatgatgcagaggagcgctgcgaccagctgatcaaaaacaagatccagctggaggccaag
gtgaaggagatgaacgagaggctggaggacgaggaggagatgaacgccgaactcaccgcc
aagaagcgcaagctggaagacgagtgctctgagctcaagaaggacattgatgacctggag
ctgacgctggccaaggtggagaaggagaagcatgcaacagagaacaaggtgaagaacctg
acagaggagatggctgggctggatgagatcatcgccaagctgaccaaggaaaagaaagct
ctgcaagaggcacaccagcaggccctggatgaccttcaggctgaggaggacaaggtcaac
acactgaccaagtctaaggtcaagctggagcagcaggtggatgatctggagggatccctg
gagcaggagaagaaagttcgaatggacctggagcgagcaaagaggaagctggaaggtgac
ctgaagctgacccaggagagcatcatggacctggagaatgataagctgcagctggaagaa
aagctcaaaaagaaggaattcgacattagtcagcagaacagtaagattgaggatgagcag
gcactggcccttcagctgcagaagaaactgaaggaaaaccaggcacgcatcgaggagctg
gaggaggagctggaggcagagcgcaccgcccgcgccaaggtggagaagctgcgctcagac
ctgtccagggagctggaggagatcagcgagcggctggaagaggccggtggggccacatcc
gtgcagatcgagatgaacaagaagcgcgaggccgagttccagaagatgaggcgggacctg
gaggaggccacgctgcagcacgaggccacggccgcagccctgcgcaagaagcacgcggac
agcgtggccgagctgggcgagcagatcgacaacctgcagcgcgtgaagcagaagctggag
aaggagaagagcgagttcaagctggagctggatgatgtcacctccaacatggagcagatc
atcaaggccaaggcaaacctggagaaggtgtcccggacactggaggaccaggccaacgag
taccgcacaaagctggaagaggcccaacgctccctcaatgatttcaccacccagcgagcc
aagctgcagactgagaacggtgagctagccaggcaactggaagaaaaggaggctctgatc
tcgcagctgacccgagggaagctctcctacacacagcaaatggaagacctcaagaggcag
cttgaggaggagggcaaggcaaagaacgccctggcccacgcactgcagtcagcccggcac
gactgtgacctgctacgggagcagtatgaggaggagacagaggccaaggccgagctacag
cgtgtcttgtccaaggctaactcagaggtggcccagtggaggaccaagtatgagacagac
gccatccagcggacagaggagctcgaggaggccaagaagaagctggcccagaggctgcag
gacgctgaggaggccgtggaggccgtcaacgccaagtgctcctctctggagaagaccaag
caccggctgcagaacgagatcgaggacctgatggtggacgtggagcgctccaacgcggcc
gccgcggccctggacaagaagcagagaaactttgacaagatcctggccgagtggaagcag
aagtacgaggagtcacagtcggaactggagtcctcacagaaggaggcgcgctctctcagc
acggagctcttcaagctcaagaacgcctacgaggagtccctggagcacctggagacctac
aagcgagagaacaagaacctgcaggaggaaatctccgacctgactgagcaattgggagaa
ggaggaaagaatgtccatgagctggagaaggtccgcaaacagctggaggtggagaagctg
gagctgcagtccgccctggaggaggccgaggcctccctggagcatgaggagggcaagatc
ctccgggcccagctggagttcaaccagatcaaggcggagatcgagcggaagctggccgag
aaggacgaggagatggagcaggccaagcgcaaccacctgcgggtggtggactcgctgcag
acctccctggacgcggagacacgcagccgcaatgaggccctgagggtgaagaagaagatg
gagggcgacctcaacgagatggagatccagctcagccaggctaacaggacagcctcagag
gcccagaagcacctgaagattgcccaagcccatctgaaggacacccaactccagatggat
gacgcagttcgagccaacgacgacctgaaggagaacatcgccatcgtggaacggcgcaac
aacctgctgcaggctgagctggaggagctgcgggccgtggtggagcagacggagcggtct
cggaagctggctgagcaggagctgatcgagaccagcgagcgggtgcagctgctgcactcc
cagaacaccagcctcattaaccagaagaagaagatggagtcagatctgacccagctccag
tcagaagtggaagaggcggtgcaggagtgcaagaacgccgaggagaaggccaagaaggcc
atcacggatgcggccatgatggcggaggagctgaagaaggagcaggacaccagcgcccac
ctggagcgcatgaagaagaacatggagcagaccatcaaggacctgcagcaccggctggat
gaggctgagcagatcgccctcaagggcggcaagaagcagctgcagaagctggaggcccgg
gtgcgagagctggagaacgagctggaggccgagcagaagcgcaacgtggagtcggtcaag
ggcatgaggaagagcgagcggcgcatcaaggagctcacttaccagacagaggaagacaag
aagaacctgctgcgtctacaggacctggtagacaagctacagctgaaggtcaaggcctac
aaacgccaggccgaggaggcagaggaacaggccaacaccaacctgtccaagttccgcaag
gtgcagcatgagctggacgaggcggaggagcgggcagacatcgccgagtcccaggtcaac
aagctgcgggccaagagccgcgatatcggcgccaagcaaaaaatgcacgatgaggagtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107498011
Entry
107498011         CDS       T06036                                 

Definition
(RefSeq) myosin-7
  KO
K17751  myosin heavy chain 6/7
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04022  cGMP-PKG signaling pathway
ray04260  Cardiac muscle contraction
ray04261  Adrenergic signaling in cardiomyocytes
ray04919  Thyroid hormone signaling pathway
ray05410  Hypertrophic cardiomyopathy
ray05414  Dilated cardiomyopathy
ray05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    107498011
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    107498011
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107498011
   04261 Adrenergic signaling in cardiomyocytes
    107498011
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107498011
   05414 Dilated cardiomyopathy
    107498011
   05416 Viral myocarditis
    107498011
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107498011
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     107498011
SSDB
Motif
Pfam: Myosin_head Myosin_tail_1 Myosin_N Crescentin IQ AAA_22 Filament
Other DBs
NCBI-GeneID: 107498011
NCBI-ProteinID: XP_015976038
LinkDB
Position
Unknown
AA seq 1935 aa
MGDAEMSAFGAAAPFLRKSEKERLEAQTRPFDLKKDVFVPDDKEEFVKAKIVSREGGKVT
AETENGKTVTVKEDDVLQQNPPKFDKIEDMAMLTFLHEPAVLYNLKERYAAWMIYTYSGL
FCVTINPYKWLPVYNAEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGES
GAGKTVNTKRVIQYFAVIAAIGDRSKKDQNPGKGTLEDQIIQANPALEAFGNAKTVRNDN
SSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERDYHIFYQILSNKKPELLDM
LLITNNPYDYAFISQGETTVASIDDSEELMATDNAFDVLGFTPEEKNSIYKLTGAIMHFG
NMKFKQKQREEQAEPDGTEEADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQNVQQV
AYATGALAKAMYEKMFNWMVTRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCINF
TNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLQACIDLIEKPMGIMSILEEECMF
PKATDMTFKAKLYDNHLGKSNNFQKPRNIKGKQEAHFSLIHYAGTVDYNILGWLQKNKDP
LNETVVGLYQKSSLKLLSNLFANYAGADAPVDKGKGKAKKGSSFQTVSALHRENLNKLMT
NLRSTHPHFVRCIIPNETKSPGVMDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFRQ
RYRILNPAAIPEGQFIDSRKGAEKLLGSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRDER
LSRIITCIQAQSRGVLSRMEFKKLLERRDSLLIIQWNIRAFMGVKNWPWMKLYFKIKPLL
KSAETEKEMANMKEEFGRLKEALEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLAD
AEERCDQLIKNKIQLEAKVKEMNERLEDEEEMNAELTAKKRKLEDECSELKRDIDDLELT
LAKVEKEKHATENKVKNLTEEMAGLDEIIVKLTKEKKALQEAHQQTLDDLQAEEDKVNTL
TKSKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKQQLDERL
KKKDFELNALNARIEDEQAVGSQLQKKLKELQARIEELEEELEAERTARAKVEKLRSDLS
RELEEISERLEEAGGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSV
AELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKMCRTLEDQMNEHR
SKAEETQRSVNDLTSQRAKLQTENGELSRQLDEKEALISQLTRGKLTYTQQLEDLKRQLE
EEVKAKNALAHALQSARHDCDLLREQYEEETEAKAELQRVLSKANSEVAQWRTKYETDAI
QRTEELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAA
ALDKKQRNFDKILAEWKQKYEESQSELESSQKEARSLSTELFKLKNAYEESLEHLETFKR
ENKNLQEEISDLTEQLGSTGKSIHELEKIRKQLEAEKLELQSALEEAEASLEHEEGKILR
AQLEFNQIKAEIERKLAEKDEEMEQAKRNHLRVVDSLQTSLDAETRSRNEALRVKKKMEG
DLNEMEIQLSHANRMAAEAQKQVKSLHSLLKDTQIQLDDAVRANDDLKENIAIVERRNNL
LQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMDADLSQLQTE
VEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEA
EQIALKGGKKQLQKLEARVRELENELEAEQKRNAESVKGMRKSERRIKELTYQTEEDRKN
LLRLQDLVDKLQLKVKAYKRQAEEAEEQANTNLSKFRKVQHELDEAEERADIAESQVNKL
RAKSRDIGTKGLNEE
NT seq 5808 nt   +upstreamnt  +downstreamnt
atgggagatgcagagatgtccgcatttggagctgctgcccccttcctgcgcaagtcagag
aaagagcgactggaagcccagaccaggcctttcgatctcaagaaggatgtctttgtgccc
gatgacaaagaagaattcgtcaaggccaagattgtgtctcgagagggtggcaaagtcacc
gctgagactgagaatggcaagacagtgactgtgaaggaggacgacgtcttgcagcagaac
ccgcccaagttcgacaagatcgaggacatggccatgctgaccttcctgcatgagcccgcg
gtgctctacaacctcaaggagcgctatgcggcctggatgatctacacctactcaggcctc
ttctgcgtcaccatcaacccctacaagtggctgccagtgtacaatgctgaggtggtggcc
gcctaccggggcaagaagaggagtgaggctccaccccacatcttctccatctccgacaac
gcctatcagtacatgctgacagacagagaaaaccagtccatcttgatcactggagaatcc
ggggccgggaagacggtcaacaccaaaagggtcattcagtactttgctgttatcgccgcc
attggggaccgcagcaagaaggaccagaacccaggcaagggcacgctggaggatcagatc
atccaggccaatcctgccttggaggcctttggcaatgccaagacggtcaggaacgacaac
tcctcccgcttcggaaaattcattcgaatccattttggggcaactggaaagttggcatct
gcagacatagagacctaccttctggaaaaatccagagttattttccagctgaaagcagag
agagattatcacattttctaccaaattctgtctaacaaaaagcctgagctgctggacatg
ctgctgatcaccaacaacccctacgattatgcattcatctcccaaggagagaccactgta
gcctcgattgatgactccgaggagctcatggccactgataacgcctttgacgtactgggc
tttactccagaggagaagaactccatttacaagctgacgggcgccatcatgcactttgga
aacatgaagttcaaacagaagcagcgagaggagcaggctgagccagacggcaccgaagag
gctgacaagtctgcctatctcatggggctgaactcagcagacctgctcaaggggctatgc
caccctcgggtgaaagtgggcaacgagtacgtcaccaaggggcagaatgtccagcaggtg
gcgtatgccactggggcactggccaaggcaatgtacgagaagatgttcaactggatggtg
acgaggatcaacgccaccctggagaccaagcagccgcgccagtacttcatcggagtcctg
gacatcgccggcttcgagatctttgacttcaacagcttcgagcagctctgcatcaacttt
accaacgagaagctgcagcagttcttcaaccaccacatgttcgtgctggagcaggaggag
tacaagaaggagggcatcgagtgggagttcattgactttggcatggacctgcaggcctgc
atcgacctcatcgagaagcccatgggcatcatgtccatcttggaggaggagtgcatgttc
cccaaggccaccgacatgaccttcaaggccaagctgtacgacaaccacctgggcaagtcc
aacaacttccagaagccgcgcaacatcaaggggaagcaggaggcccacttctccctcatc
cactacgctggcaccgtggactacaacatcctgggctggctgcagaagaacaaagacccg
ctgaacgagacggtggtgggcctgtaccagaagtcctccctcaagctgctcagcaacctg
tttgccaactatgctggggccgatgcacctgttgataagggcaaaggcaaggccaagaaa
ggctcatcctttcagactgtgtcagctctgcacagggaaaatctgaacaagctgatgacc
aacttgcgctccacacatccccacttcgtgcgctgcatcatccccaacgagaccaagtct
ccaggggtgatggacaaccccctggtcatgcaccagctgcgctgcaacggcgtgctggag
ggcattcgcatctgcaggaagggcttccccaaccgcatcctctacggcgacttccggcag
aggtatcgcatcctgaacccagcggccatccccgaagggcagttcatcgacagcaggaaa
ggggcagagaagctgctgggctccctggacattgaccacaaccagtacaagttcggccac
accaaggtgttcttcaaggcggggctgctggggctgctggaggagatgcgagatgagagg
ctgagccgcatcatcacctgcatccaggctcagtctcggggtgtgctctccagaatggag
ttcaagaagctgctagaacgcagagactccctgctgataatccagtggaacattcgggcc
ttcatgggagtcaagaactggccctggatgaagctctacttcaagatcaagccgctgctg
aagagcgcagagacggagaaggagatggccaacatgaaggaggagttcgggcgcctcaaa
gaggcgctggaaaagtccgaggctcgccgcaaggagctggaggagaagatggtatccctg
ctgcaggagaagaacgacctacagctccaagtgcaggcggaacaagacaacttggctgac
gcggaggagcgctgtgaccagctgatcaaaaacaagatccagctggaggccaaggtgaag
gagatgaacgagaggctggaggacgaggaggagatgaacgccgagctcaccgccaagaag
cgcaagctggaagacgagtgctctgagctcaaaagggacattgatgatctggagctaacg
ctggccaaggtggagaaggagaagcatgcaacagagaacaaggtgaagaacttgacagag
gagatggctgggctggacgagatcatcgtcaagctgaccaaggagaagaaagctctgcaa
gaggcacaccagcagaccctggatgaccttcaggctgaggaggacaaggtcaacacactg
accaagtctaaggtcaagctggagcagcaggtggatgatctggaggggtccctggaacag
gaaaagaaggtgcgcatggacctggagagagcaaagcggaagctggaaggcgacctgaaa
ctgacccaagagagcatcatggacctggagaacgacaagcagcagctggacgagcgactg
aaaaagaaggactttgagctgaatgccctgaatgcaaggattgaggacgagcaggctgtg
ggtagccagctgcagaagaagctcaaagagcttcaggcacgcatcgaggagctggaggag
gagctggaggcagagcgcaccgcccgcgccaaggtggagaagctgcgctcagacctgtcc
agggagctggaggagatcagcgagcggctggaagaggccggtggggccacatctgtgcag
atcgagatgaacaagaagcgcgaggccgagttccagaagatgaggcgggacctggaggag
gccacgctgcagcacgaggccacggccgcagccctgcgcaagaagcacgcggacagcgtg
gccgagctgggcgagcagatcgacaacctgcagcgcgtgaagcagaagctggagaaggag
aagagcgagttcaagctggagctggacgatgtcacctccaacatggagcagatcatcaag
gccaaggctaatctggagaagatgtgccggaccttggaagaccagatgaatgagcaccgg
agcaaagccgaggagacccagcgttctgtcaatgacctcaccagccagcgggccaagctg
cagactgagaacggtgagctgtcccgacagctggatgagaaggaggcgctgatctcccag
ctgactcgaggcaagctcacttacacccagcagctagaggacctcaaaaggcagctggag
gaggaggttaaggcaaagaacgccctggcccacgcactgcagtcagcccggcacgactgt
gacctgctacgggagcagtatgaggaggagacggaggccaaggccgagctgcagcgtgtc
ctgtccaaggccaactcagaggtggcccagtggaggaccaagtatgagacagatgccatc
cagcggacagaggagctcgaggaggccaaaaagaagctggcccagaggctgcaggacgct
gaggaggccgtggaggccgtcaacgccaagtgctcctctctggagaagaccaagcaccgg
ctgcagaacgagatcgaggacctgatggtggacgtggagcgctccaacgcggccgccgcg
gccctggacaagaagcagagaaactttgacaagatccttgccgagtggaagcagaagtac
gaggagtcacagtcggaactggagtcctcacagaaggaggcacgctctctcagcacggag
ctcttcaagctcaagaacgcctacgaggagtccctggagcacctggagaccttcaagcgg
gagaacaagaacctgcaggaggagatctccgacctgactgagcagttgggttccaccgga
aaaagcattcatgagctggagaagatccgcaagcagctggaggccgagaagctggagctg
cagtcggccctagaggaggccgaggcctccctggagcacgaggagggcaagatcctccgg
gcccagctggagttcaaccagatcaaggcggagatcgagcggaagctggccgagaaggac
gaggagatggagcaggccaagcgcaaccacctgcgggtggtggactcgctgcagacctcc
ctggacgcggagacacgcagccgcaatgaggccctgagggtgaagaagaagatggagggc
gacctcaacgagatggagatacaactcagccacgccaaccgcatggccgctgaggcccaa
aagcaagtcaagagcctccacagcttgctgaaggacacccagatccagctggacgatgcc
gtccgggccaacgacgacctgaaggagaacatcgccatcgtggaacggcgcaacaacctg
ctgcaggccgagctggaggagctgcgggccgtggtggagcagacggagcggtctcggaag
ctggctgagcaggagctgatcgagaccagcgagcgggtgcagctgctgcactcccagaac
accagcctcatcaaccagaagaagaagatggacgcagacctgtcccagcttcagacggaa
gtggaggaggcggtgcaggagtgcaggaacgccgaggagaaggccaagaaggccatcacg
gatgcggccatgatggcggaggagctgaagaaggagcaggacaccagcgcccacctggag
cgcatgaagaagaacatggagcagaccatcaaggacctgcagcaccggctggatgaggct
gagcagatcgccctcaagggcggcaagaagcagctgcagaagctggaggcccgggtgcga
gagctggagaacgagctggaggccgagcagaagcgcaacgcggagtcggtcaagggcatg
aggaagagcgagcggcgcatcaaggagctcacctaccagacagaggaggacaggaagaac
ctgctgaggctacaggacctggtggacaagctgcagttgaaggtcaaggcctacaaacgc
caggccgaagaggcggaggaacaggccaacaccaacctgtccaagttccgcaaggtgcag
cacgagctggacgaggcggaggagcgggcggacatcgccgagtcccaggtcaacaagctg
cgggccaagagccgcgacatcggcaccaagggcttaaacgaggagtag

DBGET integrated database retrieval system