KEGG   Rousettus aegyptiacus (Egyptian rousette): 107498045
Entry
107498045         CDS       T06036                                 

Gene name
NFATC4
Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 4 isoform X1
  KO
K17334  nuclear factor of activated T-cells, cytoplasmic 4
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04022  cGMP-PKG signaling pathway
ray04218  Cellular senescence
ray04310  Wnt signaling pathway
ray04360  Axon guidance
ray04625  C-type lectin receptor signaling pathway
ray04921  Oxytocin signaling pathway
ray05161  Hepatitis B
ray05163  Human cytomegalovirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107498045 (NFATC4)
   04022 cGMP-PKG signaling pathway
    107498045 (NFATC4)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107498045 (NFATC4)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107498045 (NFATC4)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107498045 (NFATC4)
  09158 Development and regeneration
   04360 Axon guidance
    107498045 (NFATC4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107498045 (NFATC4)
   05170 Human immunodeficiency virus 1 infection
    107498045 (NFATC4)
   05161 Hepatitis B
    107498045 (NFATC4)
   05163 Human cytomegalovirus infection
    107498045 (NFATC4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107498045 (NFATC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ray03000]
    107498045 (NFATC4)
Transcription factors [BR:ray03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    107498045 (NFATC4)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer TIG
Other DBs
NCBI-GeneID: 107498045
NCBI-ProteinID: XP_015976115
LinkDB
Position
Unknown
AA seq 901 aa
MGAASCEDEELEFKLVFGEEKEAPPLSTGGPGEELDSEDAPPCCRLALGEPPPYGAAPIG
IPRPPPPRPGMHSPPPRPAPSPGTWESQPARSVRLGGPGGSSGGTGGGRVLECPSIRITS
ISPTPDPPGTLEDNPDAWGDGSPRDYPPPEAFGGYREAGGQGGGAFFSPSPGSSSLSSWS
FFSDASDEAALYAACDEVESELNEAASRFGLGSPLPSPRASPRPWTPDDPWSLYGPSPAG
RGPEDSWLLLSAPGPTPASPRPASPCGKRRYSSSGTPSSASPALSRRGSLGEEGPEPPPP
PPLPLVRDPGSPGPFDYVGAPPVESIPQKTRRTSSEQAVALPRSEEPASCNGKLPSGAEE
AAAPPGGPRKEVAGMDYLAVPSPLAWSKARIGGHSPIFRTSALPPLDWPLPSQYEQLELR
IEVQPRAHHRAHYETEGSRGAVKAAPGGHPVVKLLGYNEKPLTLQMFIGTADERNLRPHA
FYQVHRITGKMVATASYEAVVSGTKVLEMTLLPENNMAANIDCAGILKLRNSDIELRKGE
TDIGRKNTRVRLVFRVHVPQGNGKVVSVQTASVPIECSQRSAQELPQVEAYSPSACSVRG
GEELVLTGSNFLPDSKVVFIERGPDGKLQWEEEAAVNRLQSNEVTLTLTVPEYSNKRVSR
PIQVYFYVSNGRRKRSPTQSFKFLPVIFKEEPIPDPSLRSFPSASGPSFGNDMDFSPPRP
PYPSYPHEDPAYETPYLSEGFSYGTPPLYPQTGPPPSYRPGLRMFPETGVTTGCARPPPV
SFLPRPFPNDLYGGRGSPFPLGLPFPPPAHFRPPLPSSPSLEGPFPPQSGAHPTPAEGYN
EVGPSYGPGEGAPEQEKSRGGYGSGFRDSVPIQGITLEEVSEIIGRDLSGFPAPPGEEPP
A
NT seq 2706 nt   +upstreamnt  +downstreamnt
atgggggcagcaagctgcgaggatgaggagctggaatttaagctggtgttcggggaggaa
aaggaagcccccccgttgagcacgggggggccgggggaagaactggactcagaggatgcc
ccaccatgctgccgtctggccctgggagagccccctccctatggcgctgcccctattggc
attcctcggccaccaccccctcggcctggcatgcactcaccgccaccccgcccagccccc
tcacctggcacttgggagagccagccagcccggtcagtgaggctgggggggccaggaggg
agctctggggggactgggggaggccgtgtccttgaatgcccaagcatccgtatcacttcc
atctctcccacgcctgacccgccaggcacgctggaggacaaccctgatgcctggggggat
ggctcccccagggattaccccccgccagaagcctttggaggctaccgagaggcagggggc
cagggcgggggcgccttcttcagcccgagccctggcagcagcagcctgtcctcgtggagc
ttcttctccgatgcctctgatgaggcagccctgtatgcggcatgcgatgaggtggagtct
gagctaaacgaagcagcctcccgctttggcctgggctccccgctgccctcgccccgggcc
tcccctaggccatggacccccgacgatccctggagcctgtatggtccgagccctgcaggc
cgagggccggaagatagctggctactcctcagcgctcctgggcccaccccggcctctcca
cggcctgcctctccctgtggcaaacggcgctattccagctccggaaccccatcttcggcc
tctccagctctgtcccgcaggggcagcctgggagaggagggacctgagccacctccacca
cccccattgcctctggtccgggaccctggctcccctggcccctttgactatgtgggagcc
ccaccagtggagagcatcccccagaaaacccggcggacttccagcgagcaggcggtggcc
ctgcctcggtctgaggagcctgcctcatgcaatgggaagctaccttccggagccgaggag
gctgcagctcctccagggggtcctcggaaggaggtggccggcatggactacctggcagtg
ccttctcctttggcttggtccaaggcccggattggaggacacagccccatcttcaggacc
tctgccctacccccactggactggcctctgcccagccagtatgagcagctggaactgagg
attgaggtgcaacctagagcccaccaccgggcccactatgaaacagagggcagccgaggt
gctgtcaaagctgcccctggtggtcatcccgtagtcaagctcctaggctataatgagaag
ccactgaccctacagatgttcattggcactgctgatgaaaggaacctgcggcctcatgcc
ttctatcaggtgcaccggatcactggcaagatggtggccacagccagctatgaagctgta
gtcagtggtacaaaggtgttggagatgaccttgcttcctgagaacaacatggcagccaac
attgactgtgctggaatcttgaagcttcggaattcagacattgagctgcggaagggtgag
acggacattggacgcaagaacacacgtgtgcggctggtgttccgggtacacgtgccccag
ggcaatgggaaggtcgtctctgtgcagactgcatcagtgcccatcgagtgctcccagcgc
tcggcacaggagctgccccaggtggaagcttacagccccagtgcttgttccgtgagagga
ggagaagaactcgtgctgactggctccaacttcctgccagactccaaggtggtgttcatt
gagagaggccctgatggaaagctgcaatgggaagaggaagctgcagtgaaccggttacag
agcaatgaggtgacactgaccctgactgtccctgagtacagcaacaagcgggtgtcccgg
cccatccaggtctacttttatgtctccaatgggcgcaggaagcgcagccctacccagagt
ttcaagttcctgcctgtgatcttcaaggaggagccgataccagacccatctctccggagc
ttcccttcagcatcgggcccctcctttggcaatgacatggacttctcaccacccagaccc
ccctatccctcctatcctcatgaagaccctgcttatgaaactccttacctgtcagaaggc
ttcagctatggcacaccccctctgtatccccagacagggcccccaccatcctacagaccc
ggccttcggatgttccctgagacaggggttaccacgggttgtgcccgcccacctccagtc
tctttccttccccggcccttccctaatgacctctatgggggacggggctccccttttccc
ctggggctgccattccctcctccagcccatttcaggcctccactgccttcctccccatcg
ctggaaggcccctttcctccccagagtggtgctcatcccacacctgctgagggatacaat
gaggtagggccaagctatggccctggggagggggctccggagcaggagaaatccaggggt
ggctacggcagcggcttccgagacagtgtccctatccagggtatcacgctggaggaagtg
agtgagatcattggccgagacctgagtggcttccctgcacctcctggagaagagcctcct
gcctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107498687
Entry
107498687         CDS       T06036                                 

Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 2-like isoform X1
  KO
K17332  nuclear factor of activated T-cells, cytoplasmic 2
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04022  cGMP-PKG signaling pathway
ray04218  Cellular senescence
ray04310  Wnt signaling pathway
ray04360  Axon guidance
ray04370  VEGF signaling pathway
ray04380  Osteoclast differentiation
ray04625  C-type lectin receptor signaling pathway
ray04650  Natural killer cell mediated cytotoxicity
ray04658  Th1 and Th2 cell differentiation
ray04659  Th17 cell differentiation
ray04660  T cell receptor signaling pathway
ray04662  B cell receptor signaling pathway
ray04921  Oxytocin signaling pathway
ray05135  Yersinia infection
ray05161  Hepatitis B
ray05163  Human cytomegalovirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05170  Human immunodeficiency virus 1 infection
ray05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107498687
   04370 VEGF signaling pathway
    107498687
   04022 cGMP-PKG signaling pathway
    107498687
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107498687
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107498687
   04650 Natural killer cell mediated cytotoxicity
    107498687
   04660 T cell receptor signaling pathway
    107498687
   04658 Th1 and Th2 cell differentiation
    107498687
   04659 Th17 cell differentiation
    107498687
   04662 B cell receptor signaling pathway
    107498687
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107498687
  09158 Development and regeneration
   04360 Axon guidance
    107498687
   04380 Osteoclast differentiation
    107498687
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107498687
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107498687
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107498687
   05170 Human immunodeficiency virus 1 infection
    107498687
   05161 Hepatitis B
    107498687
   05163 Human cytomegalovirus infection
    107498687
   05167 Kaposi sarcoma-associated herpesvirus infection
    107498687
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ray03000]
    107498687
Transcription factors [BR:ray03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    107498687
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Other DBs
NCBI-GeneID: 107498687
NCBI-ProteinID: XP_015977566
LinkDB
Position
Unknown
AA seq 939 aa
MDAPEQQPDPDGYEPGGSPQDELDFSMLFNYDYLNPIEEEPNAHKVASPPSGLAYSDDVL
DYGLKPYSPLPSLSGEPPGRFGEPDRVGFQNFLSPAKPAGASGLSPRIEITPSHELMQAG
GPVRVRDTGLLGEQAPLAAVAASPRFTLPVPGFEGYREPLCLSPASSGSSASFISDTFSP
YTSPCVSPNNGGPDDLCPQFQNIPAHYSPRTSPIMSPRTSLAEDSCLGRHSPVPRPASRS
SSPGAKRRHSCAGALVAPLPGASPQRSRSPSPQPRDDGAPAGYAPPAGPAVLMDALNSLA
ADSPCGIPTKMWKTSPDPSPAPAAPSKAGLPRHLYPAVEFLGPCEQEERRNSAPESILLV
PPPQASWVKQLVPAIPICSIPVTASLPPLEWPLSHQSGSYELRIEVQPKPHHRAHYETEG
SRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTS
YEKIVGNTKVLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRV
HIPEPSGRIVSLQTASNPIECSQRSAHELPMVERQDIDSCLVYGGQQMILTGQNFTAESK
VVFTEKTTDGQQIWEMEATVDKDKSQSNMLFVEIPEYRNKHIRTSVKVNFYVINGKRKRS
QPQHFTYHPAVPAIKTEPSDEYDPTLICSSTHGGLGSQPYYPQHPIVAESPSCLVATMAP
CQQFRSGLSSPDARYQQQNPAAALYQRSKSLSPTLLGYQQPALMAAPLSLTDAHCSVLMH
TGSQGQSSALLPSSPATQQASPVIHYSPTNQQLRCGSHQEFQHIMYCENFPPGTTRPGPP
PVSQGQRLSPGSYPTVIQQQNAPSQRAAKNGPPVSDQKEVLPTGVTIKQEQNLDQTYLDD
GKMLVFLVARRDSAQIVTRQVSCVARVSSFTSLGLSVPF
NT seq 2820 nt   +upstreamnt  +downstreamnt
atggatgccccggagcagcagcccgaccccgatggctacgagcccgggggcagcccccag
gacgagttggacttctccatgctcttcaactatgactatttgaatcctatcgaagaagaa
ccgaatgcacataaggtcgccagcccaccctccggacttgcgtactctgatgatgtcctg
gactatggcctcaagccatacagccccctccccagtctctctggcgagccccctggccga
ttcggagagccggatagggtagggttccagaactttctgagcccggccaagccagcgggg
gcctcgggcctgagccctcggatcgagatcactccgtcccacgaactgatgcaggcaggg
gggcccgtccgcgtgagagacactggcctcctgggggagcaggcgcccctggcggccgtg
gccgccagcccgaggttcaccctgcccgtgcctggcttcgagggctaccgcgagccgctt
tgcttgagccccgctagcagcggctcctctgccagcttcatttccgacaccttctccccc
tacacctcgccctgcgtctcgcccaataacggcgggcccgacgacctgtgtccccagttt
caaaacatccctgctcattattcccccagaacctcgccaataatgtcacctcgaaccagc
ctcgctgaggacagctgcctgggccgccactcgcccgtgccccgtccggcctcgcgctcc
tcgtcgcctggtgccaagcggaggcattcgtgcgccggggccttggttgccccgctgccc
ggagcctcaccccagcgctcccgcagcccctcgccgcagccgcgggacgacggcgccccc
gctgggtacgcccccccggccggccctgccgtcctcatggatgctctgaacagccttgcc
gcggactcgccttgcgggatccccaccaagatgtggaagaccagccccgacccgtcgccc
gcgcctgccgcgccgtccaaggccggcctgccccgccacctgtaccccgccgtggagttc
ctggggccctgcgaacaggaggagaggaggaactccgcccccgagtccatcctgctggtg
ccgccgcctcaggccagctgggtcaagcagctggtgcccgccattcccatctgcagtatc
ccagtgactgcatccctccctccgctcgagtggccactgtcccaccagtcgggctcctat
gagctgcggatcgaagtgcagcccaagccacaccaccgtgcccactatgagacggaaggc
agccgaggggccgtcaaagccccaaccggtggccaccctgtggttcagcttcacggctac
atggaaaacaagcccctcggccttcagatcttcatcgggacggccgacgagcggatcctg
aaaccccacgccttctaccaggtgcaccggatcacggggaaaaccgtcaccaccaccagc
tacgagaagatcgtgggcaacaccaaagtcctggagataccgctggagccgaaaaacaac
atgcgggccaccatcgactgtgcggggatcctgaagctcagaaatgctgacatcgagctg
cggaagggggagacggacatcggcaggaagaacacacgggtgaggctggttttccgggtg
cacattccggagcccagcggaaggatcgtctccttgcagactgcgtcgaaccccatcgag
tgctcccagcggtctgcccacgagctgcccatggtggaaagacaggacatcgacagctgc
ctggtgtacgggggccagcagatgatcctcacgggacagaacttcacggccgagtccaaa
gtcgtgttcacggagaagaccacagatgggcagcaaatttgggagatggaggccacggtg
gataaggacaagagccagtctaacatgctttttgttgagatccccgagtatcggaacaag
cacatccgcacgtcagtgaaagtgaacttctacgtcatcaacgggaagagaaaacggagt
cagcctcagcactttacctaccacccagcagtcccagccatcaagacggagcccagcgat
gagtatgaccccaccctgatctgtagctccacccacgggggcctggggagccagccttac
tacccgcagcacccaatagtggccgagtccccctcctgcctcgtggccaccatggctccc
tgccagcagttccgctccgggctctcgtcccccgacgcccgctaccagcagcagaacccg
gcggccgccctataccagcgcagcaagagcctgagccccaccctgctgggctaccagcag
ccagccctcatggccgccccgctgtccctcacggatgcccactgctccgtgctgatgcac
accggctcccagggccagagctcggctctgcttccctcctctccggccacccagcaggcc
tcgccggtcatccactactcgcccaccaaccagcagctgcgctgcgggagtcaccaggag
tttcagcacatcatgtactgcgagaatttcccacccggcaccaccaggcccggcccgccc
cctgtcagtcaaggtcagaggctgagcccggggtcctaccccacggtcattcagcagcag
aatgccccaagccaaagagccgccaaaaacggacccccggtcagtgaccaaaaggaagta
ttacccacgggagtgacaatcaagcaggagcagaacttggatcagacctatctggatgac
ggtaagatgctcgtttttcttgtcgcccgtagagacagtgcccagatcgtcacccgacaa
gtgtcctgtgtggcccgggtgtcctccttcacctctttgggcctcagtgtccccttttaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107500851
Entry
107500851         CDS       T06036                                 

Gene name
NFATC1
Definition
(RefSeq) LOW QUALITY PROTEIN: nuclear factor of activated T-cells, cytoplasmic 1
  KO
K04446  nuclear factor of activated T-cells, cytoplasmic 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04024  cAMP signaling pathway
ray04218  Cellular senescence
ray04310  Wnt signaling pathway
ray04380  Osteoclast differentiation
ray04625  C-type lectin receptor signaling pathway
ray04650  Natural killer cell mediated cytotoxicity
ray04658  Th1 and Th2 cell differentiation
ray04659  Th17 cell differentiation
ray04660  T cell receptor signaling pathway
ray04662  B cell receptor signaling pathway
ray04921  Oxytocin signaling pathway
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray05135  Yersinia infection
ray05161  Hepatitis B
ray05163  Human cytomegalovirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05170  Human immunodeficiency virus 1 infection
ray05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ray05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107500851 (NFATC1)
   04310 Wnt signaling pathway
    107500851 (NFATC1)
   04024 cAMP signaling pathway
    107500851 (NFATC1)
   04022 cGMP-PKG signaling pathway
    107500851 (NFATC1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107500851 (NFATC1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107500851 (NFATC1)
   04650 Natural killer cell mediated cytotoxicity
    107500851 (NFATC1)
   04660 T cell receptor signaling pathway
    107500851 (NFATC1)
   04658 Th1 and Th2 cell differentiation
    107500851 (NFATC1)
   04659 Th17 cell differentiation
    107500851 (NFATC1)
   04662 B cell receptor signaling pathway
    107500851 (NFATC1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107500851 (NFATC1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107500851 (NFATC1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107500851 (NFATC1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    107500851 (NFATC1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107500851 (NFATC1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107500851 (NFATC1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107500851 (NFATC1)
   05170 Human immunodeficiency virus 1 infection
    107500851 (NFATC1)
   05161 Hepatitis B
    107500851 (NFATC1)
   05163 Human cytomegalovirus infection
    107500851 (NFATC1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107500851 (NFATC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ray03000]
    107500851 (NFATC1)
Transcription factors [BR:ray03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    107500851 (NFATC1)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer TIG
Other DBs
NCBI-GeneID: 107500851
NCBI-ProteinID: XP_015982003
LinkDB
Position
Unknown
AA seq 925 aa
MTGLEEDQEFDFDFLFEFNHSDEGAAAAAPEHCGYAPSSLGPGLPLATAHPALPAPCHDL
QTAVPDISAVVAASHPAAYGAMXDGGRARGYFLPSSHVRPGGAPALESPRIEITSYLGLP
PGSGQLLPDVEAEGVLPGPRRPPPTATLSLPGLEAYRDPAGLSPASSLSSRSCNSEASSY
ESNYSYPYASPQTSPWQSPCVSPKTTDPEDGFPRGLGACGLLGSPRHSPSASPRTSVTEE
SWLGPRGSRPSSPCNKRKYGLDGRQPACSPQPSPAPSPHGSPRVSVTDDTWLGDSTQYAS
SAIVAAINALSTDGSLDLGDGVPTKARRTALDHAPAGALKVEPAGEDLGTTPPASDAPPE
EFAAFQHVRKGAFCEQFLAVPQQPYQWARPRSPAPYASPTLPALDWQLPSHSGPYELRIE
VQPKSHHRAHYETEGSRGAVKASAGGHPSVQLHGYGESEPLTLQLFIGTADDRLLRPHAF
YQVHRITGKTVSTTSHEAILSNTKVLEIPLLPENNMRAIIDCAGVLKLRNSDIELRKGET
DIGRKNTRVRLVFRVHIPQPDGRTLSLQVASNPIECSQRSAQELPLVEKQSTASCPVVGG
KRMVLSGHNFLQDSKVIFVEKAPDGHHIWEMEAKTDRDLCKPNSLVVEIPPFRNQRITSP
VQVNFYVCNGKRKRSQYQHFTYLPANVPIIKTEPTDDYEPALTCGPASQGLGPLPKPCYG
QQLAMPPDPGACLAAGFPPCPPRSSVMPPPPSASPKLHDLSPAPYGKGMASPGHDPLRLQ
RPAGGAFVGQEAPRPVGVHPGSPQQPQVSPQLSSSCSPGHQPALCANSPSSPLLPGAQEP
TCLQPRSPARPPGMGHLQHQLPKVPEKASAATRPLPLPEVREDSNHSLAPTPVSVKREPQ
DLDQLYLDDVNEIIRNDLSSTNVHA
NT seq 2778 nt   +upstreamnt  +downstreamnt
atgacggggctggaggaggaccaggagttcgacttcgatttcctcttcgagtttaaccac
agcgacgagggcgccgccgcggccgccccagagcactgtggttatgcaccgtccagcctc
ggccccggcctgcccctggccacggcgcaccccgcgctgccggcgccgtgccacgacctg
cagacggcggtccccgacatctcggccgtggtggcggcgagccaccccgcggcgtacggg
gccatgnnggacggcgggcgggcccgtggctacttcctgccgtccagccacgtgaggccc
ggcggcgccccggccctggagagcccgcgcatcgagatcacgtcgtacctggggctgccc
cccggcagcggccagctgctccccgacgtggaggcggagggcgtcctgcccggccccagg
cggcccccgcccacggccacgctgagcctgcccggcctggaggcctaccgcgacccggcc
ggcctgagcccggccagcagcctgtcgtcacgcagctgcaactccgaggcctcgtcctac
gagtccaactactcgtacccgtacgcgtccccacagacgtccccgtggcagtcgccctgc
gtgtcccccaagaccacggaccccgaggacggcttcccccgcggcctgggcgcctgcggc
ctgctcggctccccgaggcactcgccctccgcctcgccccgcacgagcgtcaccgaggag
agctggctggggccccgcggctcccggccctcgtccccctgcaacaagcggaagtacggc
ctcgacggccggcagccggcctgctcgccgcagccctcgcccgcgccgtccccgcacggc
tcgccgcgggtcagcgtcaccgacgacacgtggctgggcgacagcacgcagtacgccagc
tcggccatcgtggccgccatcaacgccctgagcaccgacggcagcctggacctgggcgac
ggggtgcccaccaaggcccgcaggaccgccctggaccacgcgcccgccggggcgctcaag
gtggagccggccggcgaggacctggggaccacgccgcccgcgtccgacgcgccgcccgag
gagttcgccgccttccagcacgtgcggaagggcgccttctgcgagcagttcctggcggtg
ccgcagcagccgtaccagtgggcccggcccaggtcccccgcaccctacgccagcccgacc
ctgcccgctctggactggcagctgccgtcgcactcgggaccctacgagctgaggatcgag
gtgcagccgaagtcccaccaccgagcccactacgagacggagggcagccggggggccgtg
aaggcgtcggccggaggacaccccagcgtgcagctccacggctacggggagagcgagccg
ctgacgctgcagctgttcatcgggacggcggacgaccgcctgctgaggccgcacgccttc
taccaggtgcaccgcatcacgggcaagaccgtgtccaccaccagccacgaggccatcctc
tccaacaccaaggtcctggaaatcccgcttctgccggaaaacaacatgcgtgccataatc
gactgtgccggggtcctcaagctgcggaactccgacatcgagctgcgcaagggcgagacc
gacatcggccggaagaacacccgcgtgcggctcgtcttccgcgtccacatcccgcagcct
gacggccgcacactgtcgctgcaggtcgcctcgaaccccatcgagtgctcccagcggtcg
gcacaggagctgcccctcgtggagaagcagagcacagccagctgccctgtcgtcggcggg
aagaggatggtcctatccggccataacttcctgcaggactccaaggtcattttcgtggag
aaggcgccagatggccaccacatctgggaaatggaggcgaaaaccgaccgagacctgtgc
aagccaaattcactggtggtcgagataccgccgttccgcaatcagaggataaccagcccc
gtgcaagtcaatttctacgtgtgcaacgggaagaggaagagaagccagtaccagcacttc
acctaccttcctgccaacgttcccatcatcaagacggagcccaccgacgactacgagccg
gccctgacctgtggaccagcgagccagggcctgggcccgctcccgaagccgtgctacggc
cagcagctcgccatgccgcccgacccaggagcctgcctcgcggccggcttcccgccctgc
ccaccgaggagcagcgtgatgccaccgccgcccagcgccagcccgaagctccacgacctc
tctcctgccccctacggcaagggcatggccagcccgggccatgaccccctcagacttcag
cggccagccgggggggccttcgtggggcaggaggcgccgagacccgtgggcgtgcaccca
ggctccccccagcagccacaggtgagtccacagctgagcagcagctgttccccgggtcac
cagccagcactctgtgccaacagcccctcctctccgctgctgcccggtgcccaggagccg
acctgtttgcagccccgcagcccagcccgcccacccgggatgggccatctgcagcaccag
ctgccgaaggttccggaaaaagcgtctgcagccacccggcctctgccgctgcccgaggtg
cgtgaggacagtaatcatagtctggcccccactcccgtatcggtcaagcgagagcctcaa
gacttggaccagctgtacctggatgacgtaaatgaaataatacgcaacgacctgtccagc
accaacgtccacgcgtag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107510349
Entry
107510349         CDS       T06036                                 

Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 2 isoform X1
  KO
K17332  nuclear factor of activated T-cells, cytoplasmic 2
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04022  cGMP-PKG signaling pathway
ray04218  Cellular senescence
ray04310  Wnt signaling pathway
ray04360  Axon guidance
ray04370  VEGF signaling pathway
ray04380  Osteoclast differentiation
ray04625  C-type lectin receptor signaling pathway
ray04650  Natural killer cell mediated cytotoxicity
ray04658  Th1 and Th2 cell differentiation
ray04659  Th17 cell differentiation
ray04660  T cell receptor signaling pathway
ray04662  B cell receptor signaling pathway
ray04921  Oxytocin signaling pathway
ray05135  Yersinia infection
ray05161  Hepatitis B
ray05163  Human cytomegalovirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05170  Human immunodeficiency virus 1 infection
ray05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107510349
   04370 VEGF signaling pathway
    107510349
   04022 cGMP-PKG signaling pathway
    107510349
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107510349
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107510349
   04650 Natural killer cell mediated cytotoxicity
    107510349
   04660 T cell receptor signaling pathway
    107510349
   04658 Th1 and Th2 cell differentiation
    107510349
   04659 Th17 cell differentiation
    107510349
   04662 B cell receptor signaling pathway
    107510349
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107510349
  09158 Development and regeneration
   04360 Axon guidance
    107510349
   04380 Osteoclast differentiation
    107510349
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107510349
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107510349
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107510349
   05170 Human immunodeficiency virus 1 infection
    107510349
   05161 Hepatitis B
    107510349
   05163 Human cytomegalovirus infection
    107510349
   05167 Kaposi sarcoma-associated herpesvirus infection
    107510349
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ray03000]
    107510349
Transcription factors [BR:ray03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    107510349
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Other DBs
NCBI-GeneID: 107510349
NCBI-ProteinID: XP_015999255
LinkDB
Position
Unknown
AA seq 478 aa
MENKPLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTSYEKIVGNTKVLEIPLEPKNN
MRATIDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHIPEPSGRIVSLQTASNPIE
CSQRSAHELPMVERQDIDSCLVYGGQQMILTGQNFTAESKVVFTEKTTDGQQIWEMEATV
DKDKSQSNMLFVEIPEYRNKHIRTSVKVNFYVINGKRKRSQPQHFTYHPAVPAIKTEPSD
EYDPTLICSSTHGGLGSQPYYPQHPIVAESPSCLVATMAPCQQFRSGLSSPDARYQQQNP
AAALYQRSKSLSPTLLGYQQPALMAAPLSLTDAHCSVLMHTGSQGQSSALLPSSPATQQA
SPVIHYSPTNQQLRCGSHQEFQHIMYCENFPPGTTRPGPPPVSQGQRLSPGSYPTVIQQQ
NAPSQRAAKNGPPVSDQKEVLPTGVTIKQEQNLDQTYLDDVNEIIRKEFSGPPARNQT
NT seq 1437 nt   +upstreamnt  +downstreamnt
atggaaaacaagcccctcggccttcagatcttcatcgggacggccgacgagcggatcctg
aaaccccacgccttctaccaggtgcaccggatcacggggaaaaccgtcaccaccaccagc
tacgagaagatcgtgggcaacaccaaagtcctggagataccgctggagccgaaaaacaac
atgcgtgccaccatcgactgtgcggggatcctgaagctcagaaatgctgacatcgagctg
cggaagggggagacggacatcggcaggaagaacacacgggtgaggctggttttccgggtg
cacattccggagcccagcggaaggatcgtctccttgcagactgcgtcgaaccccattgag
tgctcccagcggtctgcccacgagctgcccatggtggaaagacaggacatcgacagctgc
ctggtgtacgggggccagcagatgatcctcacgggacagaacttcacggccgagtccaaa
gtcgtgttcacggagaagaccacagatgggcagcaaatttgggagatggaggccacggtg
gataaggacaagagccagtctaacatgctttttgttgagatccccgagtatcggaacaag
cacatccgcacgtcagtgaaagtgaacttctacgtcatcaacgggaagagaaaacggagt
cagcctcagcactttacctaccacccagcagtcccagccatcaagacggagcccagcgat
gagtatgaccccaccctgatctgtagctccacccacgggggcctggggagccagccttac
tacccgcagcacccaatagtggccgagtccccctcctgcctcgtggccaccatggctccc
tgccagcagttccgctccgggctctcgtcccccgacgcccgctaccagcagcagaacccg
gcggccgccctataccagcgcagcaagagcctgagccccaccctgctgggctaccagcag
ccggccctcatggccgccccgctgtccctcacggatgcccactgctccgtgctgatgcac
accggctcccagggccagagctcggctctgcttccatcctctccggccacccagcaggcc
tcgccggtcatccactactcgcccaccaaccagcagctgcgctgcgggagtcaccaggag
tttcagcacatcatgtactgcgagaatttcccacccggcaccaccaggcccggcccgccc
cctgtcagtcaaggtcagaggctgagcccggggtcctaccccacggtcattcagcagcag
aatgccccaagccaaagagccgccaaaaacggacccccggtcagtgaccaaaaggaagta
ttacccacgggagtgacaatcaagcaggagcagaacttggatcagacctatctggatgac
gttaatgaaattatcaggaaggagttttcaggacctcccgccagaaatcagacgtag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107520480
Entry
107520480         CDS       T06036                                 

Gene name
NFATC3
Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 3 isoform X1
  KO
K17333  nuclear factor of activated T-cells, cytoplasmic 3
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04218  Cellular senescence
ray04310  Wnt signaling pathway
ray04360  Axon guidance
ray04625  C-type lectin receptor signaling pathway
ray04658  Th1 and Th2 cell differentiation
ray04659  Th17 cell differentiation
ray04660  T cell receptor signaling pathway
ray04662  B cell receptor signaling pathway
ray04921  Oxytocin signaling pathway
ray05135  Yersinia infection
ray05161  Hepatitis B
ray05163  Human cytomegalovirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05170  Human immunodeficiency virus 1 infection
ray05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107520480 (NFATC3)
   04310 Wnt signaling pathway
    107520480 (NFATC3)
   04022 cGMP-PKG signaling pathway
    107520480 (NFATC3)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107520480 (NFATC3)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107520480 (NFATC3)
   04660 T cell receptor signaling pathway
    107520480 (NFATC3)
   04658 Th1 and Th2 cell differentiation
    107520480 (NFATC3)
   04659 Th17 cell differentiation
    107520480 (NFATC3)
   04662 B cell receptor signaling pathway
    107520480 (NFATC3)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107520480 (NFATC3)
  09158 Development and regeneration
   04360 Axon guidance
    107520480 (NFATC3)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107520480 (NFATC3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107520480 (NFATC3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107520480 (NFATC3)
   05170 Human immunodeficiency virus 1 infection
    107520480 (NFATC3)
   05161 Hepatitis B
    107520480 (NFATC3)
   05163 Human cytomegalovirus infection
    107520480 (NFATC3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107520480 (NFATC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ray03000]
    107520480 (NFATC3)
Transcription factors [BR:ray03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    107520480 (NFATC3)
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Other DBs
NCBI-GeneID: 107520480
NCBI-ProteinID: XP_016019813
LinkDB
Position
Unknown
AA seq 1075 aa
MTTANCGAHDDLDFKLVFGEDGAPAPPPPGSRPADLEPDDRASIYIFNVDPPPSTLNSPL
CLPHHGLPSHSSVLSPSVQHQGHKNYEGTCEIPESKYGPLGGPKPFECPSIQITSISPNC
HQEIDAHEDDLHINDPEREYLERPSRDHLYLPLEPSYRESSLSPSPASSISSRSWFSDAS
SCESLSHIYDDVDSELNEAAARFTLGSPLTSPGGSPGGCPGEESWHQQYGLGHSLSPRQS
PCHSPRSSVTDENWLSPRPASGPSSRPTSPCGKRRHSSAEVCYAGSLSPHHSPVPSPGHS
PRGSVTEDTWLNASVQGGSGLGPALFPFQYYVETDIPLKTRKTSEDQATVLPGKLELCSD
DQGSLSPSRETSIDDGLGSQYPLKKDSSGDQFLSVPSPFTWSKPKPGHTPIFRTSSLPPL
DWPLPTHFGQCELKIEVQPKTHHRAHYETEGSRGAVKASTGGHPIVKLLGYSEKPINLQM
FIGTADDRYLRPHAFYQVHRITGKTVATASQEIIIASTKVLEIPLLPENNMSASIDCAGI
LKLRNSDIELRKGETDIGRKNTRVRLVFRVHIPQPSGKVLSLQTASIPVECSQRSAQELP
HIEKYSINSCSVNGGHEMVVTGSNFLPESKIIFLEKGQDGRPQWEVEGKIIREKCQGAHI
VLEVPPYHNPAVTAAVQVHFYLCNGKRKKSQSQRFTYTPVLMKQEHREEIDLSSVPSLPV
PHPTQIQRPSSDTGHPCDSVLSVQRSLVCPIQQTYTSLVTSSHLPQLQCRDESSGKEQHI
IPSAVMHQPFQVTPTPPVGSSYQPMQTNVYNGPTCLPINAASSQEFDSVLFQQDAVLPNL
INLGCQAPSSIPFHSSNSGSTGHLLAHTPHSVPTLPHLQSMGYHCSNSGQRCLSSPVADQ
VTGQTSPQLQSITYGPSQSGSAATVSPAVSYPLASSPLSGPPSPQLQPMPYQSPSSGTAS
SPTLATRMHSGQHSAQAQSTGQGGLSAPSTLICHNLCDPASFPSDEATVNIKPEPEEQEP
NFSTIGLQDITLDDGKFIFMFLKQWRSRNFLLLSHEKATWIAYWYVVGLSDKCCY
NT seq 3228 nt   +upstreamnt  +downstreamnt
atgactactgcaaactgtggcgcccacgacgacctcgacttcaaactcgtctttggcgag
gacggggcgccggcgccgccgcccccgggctcgcggcctgcagatcttgagccagatgat
cgtgcgtctatttacatctttaatgtagacccacctccatctactttaaactcaccactt
tgcttaccacatcatggattaccgtctcactcttctgttttgtcaccatcggttcagcac
caaggtcacaaaaactatgaaggaacttgcgagattccagaatctaaatatggcccgtta
ggtggtcccaaaccctttgagtgcccaagtattcaaattacatccatctctcctaactgt
catcaagaaatagatgctcatgaagatgacctacacataaatgacccagaaagggaatat
ttggaaagaccttctagagatcatctctatcttcctcttgagccatcttaccgggagtct
tcccttagtcctagtcctgccagcagcatctcttctaggagctggttctcagatgcatct
tcttgtgaatctctttcacatatttatgatgatgtggattcagagttgaatgaagctgct
gcacgatttactcttggatcccctctgacttctcctggtggctctccagggggctgtcct
ggagaagagtcctggcatcaacagtatggacttggacactccttgtcacccaggcagtct
ccttgccactctcctagatctagtgtcactgatgaaaattggctgagccccaggccagcc
tcgggaccctcatcaaggcctacttccccctgtgggaaacggcgacactctagtgctgag
gtttgttatgctgggtccctttcaccccatcactcacctgttccttctcctggtcactcc
cccaggggaagtgtaacagaagatacctggcttaatgcttctgtccagggtggatcaggt
cttggccctgcactttttccatttcagtactatgtagagactgatatccctctgaaaaca
aggaagacttctgaagatcaagctactgtactaccaggaaaattagagctctgttcagat
gatcaagggagtttatcgccatcccgggaaacttcaatagatgatggccttggatctcag
tatcctttaaagaaagactcatctggtgaccaatttctttcagttccttcaccctttacc
tggagcaaacccaagcctggccacacccctatatttcgcacatcttcattacctccacta
gactggcctttaccaactcattttggacaatgtgaactgaaaatagaagtgcaacctaaa
actcatcatcgggcccattatgaaactgagggtagccgaggagcagtaaaagcatctact
gggggacaccccattgtgaagctcctgggctatagtgaaaagccgataaatctacagatg
tttattggaacagcagatgatcgatatttacgacctcatgcattttaccaggtgcatcga
atcactgggaaaacagttgctactgcaagccaagagataataattgccagcacaaaggtt
ttggaaattccacttctccctgaaaataatatgtcagccagtattgactgtgcaggtatt
ttgaaacttcgcaattcagatatagaacttcgaaaaggagaaactgatattggcagaaag
aatactagagtacgacttgtgtttcgtgtacacatcccacagcccagtggaaaagtcctt
tctctgcagacagcttcaatacctgttgagtgctcccagaggtctgctcaagaacttcct
catattgagaagtacagtatcaacagttgttctgtaaatggaggtcatgaaatggttgtg
actggatctaattttcttccagaatcaaaaatcatttttcttgaaaaaggacaagatgga
cgacctcagtgggaggtagaaggaaaaataatcagggaaaaatgtcaaggggctcacatt
gtccttgaagttcctccatatcataacccagcagttacagctgcagtgcaggtgcacttt
tatctttgtaatggcaagaggaaaaaaagccagtctcaacgttttacttacacaccagtt
ttgatgaagcaagaacacagagaagaaattgacttgtcttcagttccatcattgcctgtg
cctcatcctacccagatccagagaccttcctcagacacaggacacccatgtgacagtgta
ctgtcagtacagagaagcttggtttgtcccatccagcaaacatacacatccttggtaacc
tcatcccatctgccacagttgcagtgtagagatgagagttctggtaaagaacagcatata
ataccttctgcagtcatgcaccagccttttcaagtcacaccaacacctcctgtggggtct
tcctatcagcctatgcaaactaatgtgtacaatggaccaacttgtcttcctattaatgct
gcctccagtcaagaatttgattcagttttgtttcagcaggatgccgttcttccaaattta
ataaatcttggctgccaagcgccatcatccataccttttcattcttcaaattctggctca
acaggacatctcttagcccacacacctcattctgtgccgaccctgcctcatctgcagtca
atgggataccattgctcaaatagcggacaaagatgtctttcttctccagtggctgaccag
gtcacaggtcagacttcccctcagttacagtccattacatatggtccttcacaatcaggg
tctgctgcaacagtttccccagcagtttcttatcccttggccagttcaccactttctgga
ccaccatctcctcagctacagcctatgccttaccaatctcctagctcaggaactgcctca
tcaccaactctagccaccagaatgcattctggacagcattcagctcaagcacaaagtaca
ggccagggaggtctttctgcaccttcaaccttaatatgtcacaatttgtgtgatccagct
tcatttccatctgacgaggcaactgtaaacattaaacctgaacctgaagagcaggaacct
aacttttcaacaattggtctacaggacatcactttagatgatggtaagttcatttttatg
ttcttaaagcagtggagatccaggaacttccttctcttaagtcatgagaaagctacatgg
attgcttattggtatgtggttgggctttctgataagtgttgttactag

DBGET integrated database retrieval system