KEGG   Rousettus aegyptiacus (Egyptian rousette): 107498080
Entry
107498080         CDS       T06036                                 

Gene name
GABBR1
Definition
(RefSeq) gamma-aminobutyric acid type B receptor subunit 1 isoform X1
  KO
K04615  gamma-aminobutyric acid type B receptor
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04024  cAMP signaling pathway
ray04080  Neuroactive ligand-receptor interaction
ray04727  GABAergic synapse
ray04742  Taste transduction
ray04915  Estrogen signaling pathway
ray04929  GnRH secretion
ray05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107498080 (GABBR1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107498080 (GABBR1)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    107498080 (GABBR1)
   04915 Estrogen signaling pathway
    107498080 (GABBR1)
  09156 Nervous system
   04727 GABAergic synapse
    107498080 (GABBR1)
  09157 Sensory system
   04742 Taste transduction
    107498080 (GABBR1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107498080 (GABBR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ray04030]
    107498080 (GABBR1)
G protein-coupled receptors [BR:ray04030]
 Metabotropic glutamate receptor family
  GABA
   107498080 (GABBR1)
SSDB
Motif
Pfam: ANF_receptor 7tm_3 Peripla_BP_6 Sushi UPF0242 DUF3995 PKcGMP_CC COX1
Other DBs
NCBI-GeneID: 107498080
NCBI-ProteinID: XP_015976174
LinkDB
Position
Unknown
AA seq 981 aa
MQCPWGSVRSSLPPLTQMLLLLLLLLLVPLFLRPPAAGGAQTPNATSEGCQIIHPPWEGG
IRYRGLTRDQVKAINFLPVDYEIEYVCRGEREVVGPKVRKCLANGSWTDMDIPSRCVRIC
SKSYLILENGKVFLTGGDLPALDGARVDFRCDPDFHLVGGSRSICNQGQWSTPKPHCQVN
RTPHSERRAVYIGALFPMSGGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKC
DPGQATKYLYELLYNDPIKIILMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRF
PTFFRTHPSATLHNPTRVKLFEKWGWKKIATIQQTTEVFTSTLDDLEERVKEAGIEITFR
QSFFSDPAVPVKNLKRQDARIIVGLFYETEARKVFCEVYKERLFGKKYVWFLIGWYADNW
FKTYDPSINCTVDEMTEAVEGHITTEIVMLNPANTRSISNMTSQEFVEKLTKRLKRHPEE
TGGFQEAPLAYDAIWALALALNKTSGGGGRSGVRLEDFNYNNQTITDQIYRAMNSSSFEG
VSGHVVFDASGSRMAWTLIEQLQGGSYKKIGYYDSTKDDLSWSKTDKWIGGSPPADQTLV
IKTFRFLSQKLFISVSVLSSLGIVLAVVCLSFNIYNSHVRYIQNSQPNLNNLTAVGCSLA
LAAVFPLGLDGYHIGRNQFPFVCQARLWLLGLGFSLGYGSMFTKIWWVHTVFTKKEEKKE
WRKTLEPWKLYTTVGLLVGMDVLTLAIWQIVDPLHRTIETFAKEEPKEDIDVSILPQLEH
CSSKKMNTWLGIFYGYKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVAVLCLITA
PVTMILSSQQDAAFAFASLAIVFSSYITLVVLFVPKIRRLITRGEWQSEAQDTMKTGSST
NNNEEEKSRLLEKENRELEKIIAEKEERVSELRHQLQSRQQLRSRRHPPTPPDPSGGLPR
GPPEPPDRLSCDGSRVHLLYK
NT seq 2946 nt   +upstreamnt  +downstreamnt
atgcagtgcccgtggggctccgtccggtcctcactgccgcctctcactcagatgctgctg
ctgctcctgctgctgctgttggttccgctcttcctccgccccccggccgcaggcggggcg
cagacccctaacgccacttcggaaggttgccagatcatacacccaccctgggaagggggc
atcaggtacaggggcctgactcgggaccaggtgaaggctatcaactttctgcccgtggac
tatgagattgagtatgtgtgccggggagagcgtgaggtggtggggcccaaggtccgaaag
tgcctggcaaatggctcctggacagatatggacatacccagccgttgtgtccgaatctgc
tccaagtcttatctgatcctggaaaatgggaaggtgttcctgacgggtggggacctccca
gctctagatggagcccgggtggatttccgttgtgaccctgacttccatctggtgggcggc
tcccgtagcatctgtaatcagggccagtggagcacccccaagcctcactgccaggtgaat
cgaacgccacactcagaacggcgcgcagtgtacatcggggcgctgtttcccatgagtggg
ggctggccagggggccaggcctgccagcccgcggtggagatggcgctggaggacgtgaat
agccgcagggacatcctgccggactatgagctcaagctcatccaccacgacagcaagtgt
gacccaggccaagccaccaagtacctgtacgagctgctctacaatgaccctatcaagatc
atcctcatgcctggctgtagctctgtctccacacttgtggctgaggctgctaggatgtgg
aacctcattgtgctttcctatggctccagctcaccagctctgtcaaaccgacagcgcttt
cctacattctttcgaactcatccatcagccactctccacaatcctactcgtgtgaaactc
tttgaaaagtggggctggaagaagatcgccaccatccagcagaccactgaggtcttcact
tcgactctggatgatttggaggaacgagtgaaggaagctggaatcgagattactttccgt
cagagtttcttctcagatccagccgttccggtcaaaaaccttaagcgccaggacgcccga
atcatcgtgggacttttctatgagactgaagcccggaaagttttttgtgaggtgtataag
gagaggctcttcgggaagaagtatgtctggttcctcattgggtggtatgctgacaattgg
ttcaagacctatgacccgtctatcaactgcacagtggatgaaatgaccgaggcggtggag
ggtcacatcactactgagattgtcatgctgaaccctgccaacacccgcagcatttccaac
atgacatcacaggagtttgtagaaaaactgaccaagcgactaaaaagacaccccgaggag
acaggtggcttccaggaggcaccgttggcctatgatgctatctgggccttggcattggcc
ctgaacaagacatctggagggggtggccgttcgggtgtgcgcctggaagatttcaactat
aacaaccagaccatcactgaccaaatctacagggcaatgaactcctcctcctttgagggt
gtctccggtcatgtggtgtttgatgccagcggctctcggatggcgtggacacttattgag
cagctacagggtgggagctacaagaagattggctactatgatagcaccaaagatgatctt
tcctggtccaaaacggataagtggattggagggtctccccctgctgaccagaccctggtc
atcaagacgttccgcttcctgtcacagaaactctttatctccgtctcggttctctccagc
ctgggtattgtcctagctgtagtctgtctgtcctttaacatctacaactcccatgtccgt
tatatccagaactcacagcccaacctgaataatctgactgctgtgggctgctcactggca
ttagctgctgtcttccccctcgggctggatggttaccacattggaagaaaccagttcccc
ttcgtctgccaggcccgcctctggctcctgggtctgggttttagtctgggctatggctcc
atgtttaccaaaatctggtgggtccacacagtcttcacaaagaaagaggaaaagaaagag
tggaggaagaccctggagccctggaaactgtacactacggtgggcctgctggtgggtatg
gacgtcctcactctcgccatctggcagatcgtggaccccttgcaccggaccattgagact
tttgccaaggaggaaccaaaggaagatattgatgtatctattctgccccagcttgagcac
tgcagctccaagaagatgaatacatggcttggcattttctatggttacaaggggctgctg
ctgctgctgggtatatttcttgcttatgaaaccaagagtgtgtccactgagaagatcaat
gaccaccgggctgtgggcatggccatctacaatgtggcggtcttatgcctcatcactgcc
cccgtcaccatgatcctgtccagccagcaggatgcagcctttgcctttgcctctctcgcc
atagttttttcctcctatatcactctggttgtgctcttcgtgcccaagattcgcagattg
atcacccgaggggagtggcagtcagaagctcaagacaccatgaagacagggtcatcgacc
aacaacaacgaggaagagaagtcccggctgttggagaaggagaaccgtgaactggagaag
atcattgctgagaaagaagaacgtgtatctgaattgcgccatcagctccagtctcggcag
cagctccgctcacggcgccaccctcctacacccccagacccctctgggggtctacccagg
gggccccctgagccccctgaccggcttagctgtgatgggagtcgagtccatttgctttac
aaatga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107511694
Entry
107511694         CDS       T06036                                 

Gene name
GABBR2
Definition
(RefSeq) LOW QUALITY PROTEIN: gamma-aminobutyric acid type B receptor subunit 2
  KO
K04615  gamma-aminobutyric acid type B receptor
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04024  cAMP signaling pathway
ray04080  Neuroactive ligand-receptor interaction
ray04727  GABAergic synapse
ray04742  Taste transduction
ray04915  Estrogen signaling pathway
ray04929  GnRH secretion
ray05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107511694 (GABBR2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107511694 (GABBR2)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    107511694 (GABBR2)
   04915 Estrogen signaling pathway
    107511694 (GABBR2)
  09156 Nervous system
   04727 GABAergic synapse
    107511694 (GABBR2)
  09157 Sensory system
   04742 Taste transduction
    107511694 (GABBR2)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107511694 (GABBR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ray04030]
    107511694 (GABBR2)
G protein-coupled receptors [BR:ray04030]
 Metabotropic glutamate receptor family
  GABA
   107511694 (GABBR2)
SSDB
Motif
Pfam: 7tm_3 ANF_receptor GBR2_CC Peripla_BP_6 Cation_ATPase_C GAPT GWT1 DUF812 APG6_N HOOK
Other DBs
NCBI-GeneID: 107511694
NCBI-ProteinID: XP_016001780
LinkDB
Position
Unknown
AA seq 941 aa
MASPRSSGQPGPPPRRATAAARLLLLLLLPLLLLLAPGAWGWARGAPRPPPSSPPLSIMG
LMPLTKEVAKGSIGRGVLPAVELAIEQIRNESLLRPYFLDLRLYDTECDNAKGLKAFYDA
IKYGPNHLMVFGGVCPSVTSIIAESLQGWNLVQLSFAATTPVLADKKKYPYFFRTVPSDN
AVNPAILKLLKYYQWKRVGTLTQDVQRFSEVRNDLTGVLYGEDIEISDTESFSNDPCTSV
KKLKGNDVRIILGQFDQNMAAKVFCCAYEENMFGSKYQWIIPGWYEPSWWEQVHTEANSS
RCLRKNLLAAMEGYIGVDFEPLSSKQIKTISGKTPQQYEREYNNKRSGVGPSKFHGYAYD
GIWVIAKTLQRAMETLHASSRHQRIQDFNYTDHTLGRIILNAMNETNFFGVTGQVVFRNG
ERMGTIKFTQFQDSREVKVGEYNAVADTLEIINDTIRFQGSEPPKDKTIILEQLRKISLP
LYSILSALTILGMIMASAFLFFNIKNRNQKLIKMSSPYMNNLIILGGMLSYASIFLFGLD
GSFVSEKTFETLCTVRTWILTVGYTTAFGAMFAKTWRVHAIFKNVKMKKKIIKDQKLLVI
VGGMLLIDLCILICWQAVDPLRRTVERYSMEPDPAGRDISIRPLLEHCENTHMTIWLGIV
YAYKGLLMLFGCFLAWETRNVSIPALNDSKYIGMSVYNVGIMCIIGAAVSFLTRDQPNVQ
FCIVALVIIFCSTITLCLVFVPKLITLRTNPDAATQNRRFQFTQNQKKEDSKTSTSVTSV
NQASTSRLEGLQSENHRLRMKITELDKDLEEVTMQLQDTPEKTTYIKQNHYQELNDILNL
GNFTESTDGGKAILKNHLDQNPQLQWNTTEPSRTCKDPIEDINSPEHIQRRLSLQLPILH
HAYLPSIGGVDASCVSPCVSPTASPRHRHVPPSFRVMVSGL
NT seq 2826 nt   +upstreamnt  +downstreamnt
atggcttctccgcggagctccgggcagcccggcccgccgccgcgccgcgccaccgccgcc
gcgcgcctgctgctgctcctgctgctgccgctcctgctgctcttggcgcccggggcctgg
ggctgggcgcggggtgccccccggccgccgcccagcagcccgccgctctccatcatgggc
ctcatgccgctcaccaaggaggtggccaagggcagcatcgggcgcggcgtgcttcccgcg
gtggaactggccatcgagcaaatccgcaacgagtcgctcctgcgcccctacttcctcgac
ctgcggctctacgacacagagtgtgataatgcaaaagggttgaaagccttctacgatgca
ataaaatacggaccgaaccacttgatggtgtttggaggcgtctgtccatccgttacgtcc
atcatcgcagagtccctccaaggctggaacctggtacagctctcttttgctgcgaccaca
cctgttctagctgataagaaaaaatacccttatttcttccggactgtcccgtcagataat
gcggtgaatccagccatcttgaagctgctaaagtactaccagtggaagcgagtgggaacg
ctaacacaagacgtgcagaggttctcggaggttaggaacgacctgactggagttctgtat
ggtgaggacatcgagatttcagacaccgagagcttctccaatgatccttgcaccagtgtc
aagaagcttaagggcaatgacgtgaggatcatccttggccagtttgaccagaatatggca
gcgaaagtgttctgttgtgcatatgaggagaacatgttcggtagcaaataccagtggatc
attccaggctggtatgagccttcctggtgggagcaggtgcatacagaagccaactcatcc
cgttgtctccggaagaatctgcttgctgccatggagggctacatcggcgtggactttgag
cccctgagctccaagcagatcaagaccatctcaggaaagactccacagcagtatgaaaga
gagtacaacaataagcggtcaggtgtggggcccagtaagttccatgggtatgcctacgat
ggcatctgggtcatcgccaagacgctgcagagggccatggagacgctgcacgccagcagc
cgacaccagcggatccaggatttcaactacacagaccacacgctgggccggatcatcctc
aacgccatgaatgagaccaacttcttcggggtcacgggtcaagttgtgttccggaatggg
gagagaatggggaccattaaatttactcaatttcaagacagcagggaggtgaaggtggga
gagtacaacgcggtggccgacacgctggagatcatcaatgacaccattaggttccaagga
tccgaaccaccaaaagacaagaccatcatcctagagcagctccggaagatctccctacct
ctctacagcatcctctctgccctcaccatcttggggatgatcatggccagcgcttttctc
ttcttcaacatcaagaaccggaatcagaagctgataaagatgtcgagcccttatatgaac
aacctcatcatcctcggaggaatgctctcctacgcatccatctttctctttggcctggat
ggatcctttgtctctgaaaagaccttcgaaacactttgcactgtcaggacctggatcctc
accgtgggctacacaaccgcctttggggcaatgtttgcaaagacttggagggtccacgcc
atcttcaaaaatgtgaaaatgaagaagaagatcatcaaggaccagaaactgctcgtgatt
gtcgggggcatgctgctgatcgacctgtgcatcctgatctgctggcaggctgtggacccc
ctgagaaggacggtggagaggtacagcatggagccggacccagcaggacgggacatctcc
atccgccctctcctggagcactgcgagaacacccacatgaccatctggctcggcatcgtc
tatgcctacaaggggctgctcatgttgttcggttgtttcttagcttgggagacgcgcaac
gtcagcatccccgcgctcaacgacagcaagtacatcgggatgagcgtctacaacgtggga
atcatgtgcatcattggggccgccgtctccttcctgacgcgggaccagcccaacgtgcag
ttctgcatcgtggccctcgtcatcatcttctgcagcaccatcaccctctgcctggtgttt
gtgccgaagctcatcactctgagaacaaacccagatgcagcaactcagaacagacgattc
cagttcactcagaatcagaagaaagaagattctaaaacatccacctcagtcaccagcgtg
aaccaagcaagcacatcccgcctagagggcctgcaatcagaaaaccatcgtctgcgaatg
aaaatcacagagctggataaagacttggaagaggtcaccatgcagctgcaggacacacca
gaaaagaccacctacattaaacagaaccactaccaagagctcaatgacatcctcaacctg
gggaatttcactgagagcacagatgggggaaaggccattttaaaaaatcacctcgatcaa
aatccccagctacaatggaacacaacagagccctcccgaacatgcaaagatcctatagaa
gatataaactccccagaacacatccagcgccggctgtcgctacagctccccatcctccac
cacgcctacctcccgtccattggaggcgtggacgccagctgtgtcagcccctgtgtcagc
cccaccgccagcccccgtcacagacatgtgccaccctccttccgagttatggtctcgggc
ctgtaa

DBGET integrated database retrieval system