KEGG   Rousettus aegyptiacus (Egyptian rousette): 107498187
Entry
107498187         CDS       T06036                                 

Gene name
RALBP1
Definition
(RefSeq) ralA-binding protein 1 isoform X1
  KO
K08773  RalA-binding protein 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04014  Ras signaling pathway
ray05200  Pathways in cancer
ray05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107498187 (RALBP1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107498187 (RALBP1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    107498187 (RALBP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107498187 (RALBP1)
Membrane trafficking [BR:ray04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    107498187 (RALBP1)
SSDB
Motif
Pfam: RhoGAP Nod1
Other DBs
NCBI-GeneID: 107498187
NCBI-ProteinID: XP_015976461
LinkDB
Position
Unknown
AA seq 655 aa
MTECFLPPTSSPGEHRRVEHGSGLTRTPSSEEISPTKFPGLYRTGEPSPPHDSLHEPPDI
VSDDEKDYGKKKGKFKKKEKRTEGYAAFQEDSSGDEAESPSKMKRSKGIHVFKKPSFSKK
KEKDFKIKEKPKEEKHKEEKHKEEKHKEKKSKDLTAADVVKQWKEKKKKKKPIQEPEVPQ
IDVPNLKPIFGIPLADAAERTMMYDGIRLPAVFRECVDYVEKYGMKCEGIYRVSGIKSKV
DELKAAYDREESPNLEEYEPNTVASLLKQYLRDLPENLLTKELMPRFEEACGRSTESEKV
QEFQRLLKELPECNHLLISWLIVHMDHVITKELETKMNIQNISIVLSPTVQISNRVLYVF
FTHVQELFGNVILKQVTKPLRWSNMATMPTLPETQENIKEEIRRQEFLLNCLHRDLQGGI
KDLSKEERLWEVQRILTALKRKLREAKRQECETKIAQEIASLSKEDVSKEEMNENEEVIN
ILLAQENEILTEQEELLAMEQFLRRQIASEKEEIERLRAEIAEIQSRQQHGRSETEEYSS
ESESESEDEEELQIILEDLQRQNEELEIKNNHLNQAIHEEREAIIELRVQLRLLQLQRAK
PDAQAQDEEEPEKRGGAIQPPKECAPETKATKEQPKASKEQAKPSPSRDRKETPI
NT seq 1968 nt   +upstreamnt  +downstreamnt
atgactgagtgcttcttgccccccaccagcagccccggtgaacaccgcagggtggagcat
ggcagtggtcttacccgaacccccagctctgaggaaatcagccctactaaatttcctgga
ttgtaccgcactggcgagccctcacctccccatgacagtctccatgagcctcctgatata
gtgtcggatgatgagaaagattatgggaagaaaaagggaaaatttaagaaaaaggaaaaa
aggactgaaggctatgctgcctttcaggaagatagctctggagatgaagctgaaagtcct
tccaaaatgaagagatccaagggaatccatgtttttaagaagcccagcttttctaaaaag
aaagagaaggattttaaaataaaagagaaacccaaagaggaaaaacataaagaagaaaag
cacaaagaagaaaaacataaagagaagaagtcaaaagacttgacagcagctgatgttgtt
aaacagtggaaggaaaagaagaaaaagaagaagccaattcaggagccagaggtgcctcag
atcgatgttccgaatctcaaacctatttttggaattcctttggctgacgcagcagagagg
accatgatgtatgatggcattcgactgccagcagttttccgtgaatgcgtagattatgta
gagaagtatgggatgaagtgtgaaggcatctacagagtttcaggaattaaatcaaaagtg
gatgagctgaaagcagcctatgacagagaggagtctccaaatttggaagaatatgagccc
aacactgtagccagtttgctgaagcagtatttgcgagaccttccggaaaatctgcttacc
aaagagcttatgcctcgctttgaagaggcttgtgggaggagtacagaaagtgagaaagta
caggagttccagcgcttactgaaagagctgccagaatgtaaccatcttctgatttcttgg
ctgattgtgcacatggatcatgttatcacaaaggagctggaaacaaaaatgaacatacag
aacatttctatagtgctcagtccaactgttcagattagcaatcgcgtcctatatgtgttt
ttcacacatgtgcaagagctctttggaaatgtgatattaaagcaagtcacaaaacctctt
cgttggtctaacatggccactatgcctacactgccagaaacgcaggagaacatcaaggag
gagatcagaagacaggagtttcttttgaattgtttacatagagatctacaaggtgggata
aaggatttatctaaagaagaaagattatgggaggtacaaagaattttgacagccctcaaa
agaaaactgagagaagctaaaagacaggagtgtgaaaccaagattgcacaagagatagcc
agtctttcaaaagaggatgtttccaaagaagaaatgaatgaaaatgaagaggttataaat
attcttcttgcccaggagaatgaaatcctgactgaacaggaggagcttctagccatggag
caatttctgcgccgacagatcgcctcagaaaaagaagagattgaacgcctcagagctgag
attgctgaaattcagagtcgtcagcaacatggccgaagtgaaactgaggaatactcctct
gaaagtgaaagtgaaagtgaagacgaagaggagcttcagatcatcttggaagatttacag
agacagaatgaagagttagaaataaagaacaatcatttgaatcaagcaattcatgaagag
cgagaggccatcatcgaactgcgtgtgcagctccgcctgctgcagctgcagagagccaag
cctgatgcccaggcacaggatgaggaggagcccgagaaacgtggcggtgccatccagccg
cctaaggaatgcgccccagagacaaaagcaactaaagagcagccaaaggcaagcaaggag
caggccaagccctcgccgagcagagacagaaaggagacgcccatctga

DBGET integrated database retrieval system