KEGG   Rousettus aegyptiacus (Egyptian rousette): 107498223
Entry
107498223         CDS       T06036                                 

Gene name
PRF1
Definition
(RefSeq) perforin-1
  KO
K07818  perforin 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04210  Apoptosis
ray04650  Natural killer cell mediated cytotoxicity
ray04940  Type I diabetes mellitus
ray05320  Autoimmune thyroid disease
ray05330  Allograft rejection
ray05332  Graft-versus-host disease
ray05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107498223 (PRF1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107498223 (PRF1)
 09160 Human Diseases
  09163 Immune disease
   05320 Autoimmune thyroid disease
    107498223 (PRF1)
   05330 Allograft rejection
    107498223 (PRF1)
   05332 Graft-versus-host disease
    107498223 (PRF1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107498223 (PRF1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107498223 (PRF1)
SSDB
Motif
Pfam: MACPF C2
Other DBs
NCBI-GeneID: 107498223
NCBI-ProteinID: XP_015976562
LinkDB
Position
Unknown
AA seq 555 aa
MATCVLLLGILLLLLPTPTPAPCHTAARSECRRVRSFVPGSWLAGEGVDVTSLRRSGSFP
VDTQRFLRPDGTCTLCRNALQRGALQRLPLALTDWRAQGSGCQRRVVRSKLSSTEAVASG
AASSIRNDWRVGLDVNPKPSSSARVSVAGSHSKAADFAAQKTHQDQYSFSTDLVECRFYS
FHLVHSPPLHPDFKKALRALPHNFNTSTESDYLRLISNYGTHFIRSMELGGRISALTALR
TCELALEGLTADEVGDCLAVEAEVSIGGHASSSSEIKACEEKKKQLKMTASFHQAYRERY
SEVVGGDHTSMHDLLFGNHAGPEQFSAWVASLQDSPSLVDYTLEPLHVLLESKDPRREAL
RLAVSKYVMRRARWRDCSRPCPPGQQKSPRNPCQCVCHGSGAISQDCCPRKRGLAKLEVM
NFHARDLWGDTFTATDAYVKVFFGGQERRTGTVWNSNNPEWATTLDFGDVVLATGGPLRV
QVWDADSGWDDDLLGTCDRTPQSGLQHVECNLNHGHLKFSYRAKCLPHLTGKACLQYAPQ
GLLGEPPGNRSGAVW
NT seq 1668 nt   +upstreamnt  +downstreamnt
atggccacctgtgtgctcctcttgggcatcctcttgctgttgctgcccacgcccacccct
gccccctgccacactgccgcccgctctgagtgccgacgtgttcgcagtttcgtgcctggc
tcatggctggcgggggagggcgtggatgtgaccagcctccggcgctcaggctccttccca
gtggacacacagcgctttctgcggccggatggcacctgcaccctctgccgcaacgccctg
cagcggggtgccctccagcgcctgcccctggcacttaccgactggcgggcccagggctca
ggctgccagcgccgtgtggtcagatccaagctcagctccaccgaagccgtggctagcggg
gcggccagcagcatccgcaacgactggcgggtggggctggacgtaaaccccaagcccagc
agcagcgctcgcgtgtcagtggcaggctcgcactctaaggcggcagattttgccgcccag
aaaacccaccaggaccagtacagcttcagcactgacttggtggagtgtcgcttctacagt
tttcacctggtacactctcccccactccaccccgatttcaagaaggctctcagggccctg
ccccacaacttcaacacctccacagagtctgactacctccggctcatctccaattatggc
acccattttatccgctccatggaactgggaggccggatctcagcccttaccgccctgcgt
acctgcgagctggccctggaagggctcacagccgacgaggtgggagactgcctggccgtc
gaggctgaggtcagcataggtggccatgccagctcctcgtcggaaatcaaggcctgtgag
gagaagaagaagcagctcaagatgacagcctccttccaccaggcctaccgggaacgctac
tctgaagtagtaggcggtgaccatacctccatgcatgacctgttgttcgggaaccacgct
gggcccgagcagttctcagcctgggtggcctcactgcaggacagccccagcctagtagac
tacaccctggagcctctgcatgtgctcttggagagcaaggacccacggcgggaggcactg
aggctagccgtgagcaagtatgtgatgcgcagggcacgctggagggactgcagccggccc
tgccccccagggcagcagaagagcccccgcaacccctgccaatgtgtgtgccatggctca
ggggccatcagccaggactgctgtccccggaagaggggtttggccaagctggaggttatg
aacttccacgccagagatctgtggggagatacattcactgcaacagacgcctatgtgaag
gttttctttggaggccaggagcggaggacgggcacagtgtggaatagtaacaaccctgag
tgggcgacgacgctggacttcggggacgtggtcctggccacaggggggcccctgagggtg
caggtctgggatgcagactctggctgggacgatgacctcctcggcacctgtgaccggact
ccacagtctggcttacaacacgtggagtgtaacctgaatcatggtcacctgaaattctcc
taccgtgccaaatgtttgcctcatctgacggggaaagcctgcctgcagtacgccccccaa
gggcttctgggggagcctccaggaaaccggagcggagcagtgtggtga

DBGET integrated database retrieval system