KEGG   Rousettus aegyptiacus (Egyptian rousette): 107498267
Entry
107498267         CDS       T06036                                 

Gene name
YWHAQ
Definition
(RefSeq) 14-3-3 protein theta
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04110  Cell cycle
ray04114  Oocyte meiosis
ray04151  PI3K-Akt signaling pathway
ray04390  Hippo signaling pathway
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    107498267 (YWHAQ)
   04151 PI3K-Akt signaling pathway
    107498267 (YWHAQ)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107498267 (YWHAQ)
   04114 Oocyte meiosis
    107498267 (YWHAQ)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107498267 (YWHAQ)
  09172 Infectious disease: viral
   05161 Hepatitis B
    107498267 (YWHAQ)
   05160 Hepatitis C
    107498267 (YWHAQ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ray03400]
    107498267 (YWHAQ)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107498267 (YWHAQ)
DNA repair and recombination proteins [BR:ray03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    107498267 (YWHAQ)
Exosome [BR:ray04147]
 Exosomal proteins
  Proteins found in most exosomes
   107498267 (YWHAQ)
SSDB
Motif
Pfam: 14-3-3 FliM
Other DBs
NCBI-GeneID: 107498267
NCBI-ProteinID: XP_015976640
LinkDB
Position
Unknown
AA seq 245 aa
MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWR
VISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLK
MKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYE
ILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAA
EGAEN
NT seq 738 nt   +upstreamnt  +downstreamnt
atggagaagacggagctgatccagaaggcgaagctggccgagcaggccgagcgctacgac
gacatggccacctgcatgaaggccgtgacggagcagggcgccgagctgtccaacgaggag
cgcaacctgctctcggtggcctacaagaacgtggtcgggggccgccggtccgcctggagg
gtcatctcgagcatcgagcagaaaaccgacacctccgacaagaagttgcagctgattaag
gactatcgggagaaagtggagtcggagctgcggtccatctgcaccacggtgctggaattg
ttggataagtatttaatagccaatgcaactaatccagagagtaaggtcttctatctgaaa
atgaagggggattacttccggtaccttgcggaagttgcatgtggtgatgatcgaaaacaa
acgatagataattcccaaggagcttaccaagaggcttttgatataagcaagaaagagatg
cagcccacacacccaattcgtctggggctggctcttaacttttctgtattttactatgag
atccttaataacccagagcttgcctgcacactggctaaaacggctttcgatgaggctatt
gcagaacttgatacactgaatgaagactcttacaaagacagcaccctcatcatgcagttg
cttagagacaacctaacattatggacatcagacagtgcaggagaagaatgtgacgcggca
gaaggggcagaaaactaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107502395
Entry
107502395         CDS       T06036                                 

Gene name
YWHAH
Definition
(RefSeq) 14-3-3 protein eta
  KO
K16198  14-3-3 protein gamma/eta
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04110  Cell cycle
ray04114  Oocyte meiosis
ray04151  PI3K-Akt signaling pathway
ray04390  Hippo signaling pathway
ray05160  Hepatitis C
ray05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    107502395 (YWHAH)
   04151 PI3K-Akt signaling pathway
    107502395 (YWHAH)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107502395 (YWHAH)
   04114 Oocyte meiosis
    107502395 (YWHAH)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107502395 (YWHAH)
  09172 Infectious disease: viral
   05160 Hepatitis C
    107502395 (YWHAH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107502395 (YWHAH)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ray03400]
    107502395 (YWHAH)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107502395 (YWHAH)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107502395 (YWHAH)
DNA repair and recombination proteins [BR:ray03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    107502395 (YWHAH)
Exosome [BR:ray04147]
 Exosomal proteins
  Proteins found in most exosomes
   107502395 (YWHAH)
SSDB
Motif
Pfam: 14-3-3 DUF722 CodY
Other DBs
NCBI-GeneID: 107502395
NCBI-ProteinID: XP_015985042
LinkDB
Position
Unknown
AA seq 246 aa
MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSW
RVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLALLDKFLIKNCNDFQYESK
VFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEHMQPTHPIRLGLALNFS
VFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDE
EAGEGN
NT seq 741 nt   +upstreamnt  +downstreamnt
atgggcgaccgggagcagctgctgcagcgggcgcggctggccgagcaggcggagcgctac
gacgacatggcctctgccatgaaggcggtgacagagctgaatgaacctctctccaacgaa
gatcgaaaccttctctctgttgcctataagaatgtggttggtgccaggcggtcttcctgg
agggtcatcagcagcattgagcagaaaaccatggctgatggaaatgaaaagaagttggag
aaggttaaagcttatcgggagaagattgagaaggagctggaaacagtgtgcaacgatgtc
ctggctctgctcgacaagttcctcattaagaactgcaacgatttccagtacgagagcaag
gtattttatctgaaaatgaaaggtgattactaccgctacttggcagaggtagcttctggg
gagaagaaaaacagtgtggtcgaagcttctgaggcggcctacaaggaagcctttgaaatt
agcaaagagcacatgcagccaacgcaccccatccgtctgggcctggccctcaacttctcc
gtgttctactacgagatccagaatgcacctgagcaggcctgcctcttagccaaacaagcc
ttcgatgatgccatagccgagctggacacactaaatgaggattcctataaggactccacg
ctcatcatgcagttactgcgagacaaccttaccctctggacgagcgaccagcaggatgag
gaagcaggagaaggcaactga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107507733
Entry
107507733         CDS       T06036                                 

Gene name
YWHAE
Definition
(RefSeq) 14-3-3 protein epsilon
  KO
K06630  14-3-3 protein epsilon
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04110  Cell cycle
ray04114  Oocyte meiosis
ray04151  PI3K-Akt signaling pathway
ray04390  Hippo signaling pathway
ray04621  NOD-like receptor signaling pathway
ray04722  Neurotrophin signaling pathway
ray05160  Hepatitis C
ray05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    107507733 (YWHAE)
   04151 PI3K-Akt signaling pathway
    107507733 (YWHAE)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107507733 (YWHAE)
   04114 Oocyte meiosis
    107507733 (YWHAE)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107507733 (YWHAE)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107507733 (YWHAE)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107507733 (YWHAE)
  09172 Infectious disease: viral
   05160 Hepatitis C
    107507733 (YWHAE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ray03400]
    107507733 (YWHAE)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107507733 (YWHAE)
DNA repair and recombination proteins [BR:ray03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    107507733 (YWHAE)
Exosome [BR:ray04147]
 Exosomal proteins
  Proteins found in most exosomes
   107507733 (YWHAE)
SSDB
Motif
Pfam: 14-3-3 Orbi_VP5 Ta0938
Other DBs
NCBI-GeneID: 107507733
NCBI-ProteinID: XP_015994455
LinkDB
Position
Unknown
AA seq 255 aa
MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASW
RIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVF
YYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVF
YYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGE
EQNKEALQDVEDENQ
NT seq 768 nt   +upstreamnt  +downstreamnt
atggatgatcgggaggatctggtgtaccaggcgaagctggccgagcaggctgagcgatat
gacgaaatggtggaatcaatgaagaaagtagcaggaatggatgtggagttaacagttgaa
gaaaggaacctcctatctgttgcatataaaaatgtgattggagctagaagagcttcctgg
agaataatcagcagcattgaacagaaagaagaaaacaaggggggagaagacaaactaaaa
atgattcgggagtatcggcaaatggttgagactgagctaaagttaatctgttgtgacatt
ctggatgtactggacaaacacctcattccagcagctaacactggcgagtccaaggttttc
tattataaaatgaaaggggactaccacaggtatctggctgaatttgccacaggaaatgac
aggaaggaggctgcggagaacagcctagtggcttataaagctgctagtgatattgcaatg
acagaacttccaccaacgcatcccattcgcttaggtcttgctctgaatttttccgtattc
tactatgaaattcttaattcccctgaccgtgcctgcaggttggcaaaagcagcttttgat
gatgcaattgcagaactggatacgctgagtgaagaaagctataaggactctacacttatc
atgcagttgttacgtgataatctgacactatggacttcagacatgcagggtgatggtgaa
gagcagaataaagaagcgctgcaggatgtggaagatgaaaatcagtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107511797
Entry
107511797         CDS       T06036                                 

Gene name
YWHAG
Definition
(RefSeq) 14-3-3 protein gamma
  KO
K16198  14-3-3 protein gamma/eta
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04110  Cell cycle
ray04114  Oocyte meiosis
ray04151  PI3K-Akt signaling pathway
ray04390  Hippo signaling pathway
ray05160  Hepatitis C
ray05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    107511797 (YWHAG)
   04151 PI3K-Akt signaling pathway
    107511797 (YWHAG)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107511797 (YWHAG)
   04114 Oocyte meiosis
    107511797 (YWHAG)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107511797 (YWHAG)
  09172 Infectious disease: viral
   05160 Hepatitis C
    107511797 (YWHAG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107511797 (YWHAG)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ray03400]
    107511797 (YWHAG)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107511797 (YWHAG)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107511797 (YWHAG)
DNA repair and recombination proteins [BR:ray03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    107511797 (YWHAG)
Exosome [BR:ray04147]
 Exosomal proteins
  Proteins found in most exosomes
   107511797 (YWHAG)
SSDB
Motif
Pfam: 14-3-3 DUF722 DUF3504 Peptidase_C98 Orbi_VP5 SF3A2 FlaC_arch
Other DBs
NCBI-GeneID: 107511797
NCBI-ProteinID: XP_016002026
LinkDB
Position
Unknown
AA seq 247 aa
MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSW
RVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESK
VFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYS
VFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDD
DGGEGNN
NT seq 744 nt   +upstreamnt  +downstreamnt
atggtggaccgcgagcaactggtgcagaaagcccggctggccgaacaggcggagcgctac
gacgacatggccgcggccatgaagaacgtgacagagctgaatgagccactgtctaacgaa
gaaagaaaccttctttctgtggcctacaagaatgtagttggggcacgccgttcttcctgg
agggtcattagtagcatcgagcagaagacatctgcagatggtaatgagaagaagatagag
atggtccgtgcttaccgtgaaaaaatagagaaggagttagaagcagtatgtcaggatgtg
ctgagcctgctggataactacctgatcaagaattgcagtgagacccagtatgagagcaaa
gtgttttacctgaagatgaaaggggactattatcgctacctggctgaagtagccaccgga
gagaaaagggcaactgtggtggaatcatctgagaaggcctatagtgaagcccatgagatc
agcaaggagcacatgcagcctactcaccccattagattaggcctggctcttaactactcc
gttttctactatgagatccagaatgccccggagcaagcatgccacttggccaagaccgcc
ttcgacgatgccattgccgagctcgacactctcaatgaggactcctacaaggactccact
ctaatcatgcagctcctccgcgacaacctaacgctctggacaagcgatcagcaagatgac
gatggtggagaaggcaacaattaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107512228
Entry
107512228         CDS       T06036                                 

Definition
(RefSeq) 14-3-3 protein zeta/delta
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04110  Cell cycle
ray04114  Oocyte meiosis
ray04151  PI3K-Akt signaling pathway
ray04390  Hippo signaling pathway
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    107512228
   04151 PI3K-Akt signaling pathway
    107512228
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107512228
   04114 Oocyte meiosis
    107512228
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107512228
  09172 Infectious disease: viral
   05161 Hepatitis B
    107512228
   05160 Hepatitis C
    107512228
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ray03400]
    107512228
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107512228
DNA repair and recombination proteins [BR:ray03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    107512228
Exosome [BR:ray04147]
 Exosomal proteins
  Proteins found in most exosomes
   107512228
SSDB
Motif
Pfam: 14-3-3 CSN7a_helixI FliM Peptidase_C98
Other DBs
NCBI-GeneID: 107512228
NCBI-ProteinID: XP_016003034
LinkDB
Position
Unknown
AA seq 245 aa
MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWR
VVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLK
MKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYE
ILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAG
EGGEN
NT seq 738 nt   +upstreamnt  +downstreamnt
atggataaaaatgagctggtgcagaaggccaaactggccgagcaggctgaacgatatgat
gacatggcagcctgcatgaagtctgtaactgagcaaggagctgaattatccaatgaggag
aggaatcttctctcagttgcttataaaaatgttgtaggagctcgtaggtcatcttggagg
gtcgtctcaagtattgagcaaaagacggaaggtgctgagaaaaaacagcagatggctcga
gaataccgagagaaaattgaaaccgagctaagagatatctgcaatgatgtactgtctctc
ttggaaaagttcttgattcctaatgcttcacaagcagagagcaaagtcttctatttgaaa
atgaaaggagactactaccgttacttggctgaggttgctgctggtgatgataagaaaggg
attgtggatcagtcacaacaggcataccaggaagcttttgaaatcagcaaaaaggaaatg
caaccaacacatcctatcagattgggtctggcccttaacttctctgtgttctattacgag
attctgaactccccggagaaagcctgttctcttgcaaagacagcttttgatgaagccatt
gctgaacttgatacattaagtgaagagtcatacaaagacagcacgctaataatgcaatta
ctgagggacaacttgacattgtggacatcggatacccaaggagatgaagctgaagcagga
gaaggaggagaaaattaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107514565
Entry
107514565         CDS       T06036                                 

Gene name
YWHAB
Definition
(RefSeq) 14-3-3 protein beta/alpha
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04110  Cell cycle
ray04114  Oocyte meiosis
ray04151  PI3K-Akt signaling pathway
ray04390  Hippo signaling pathway
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    107514565 (YWHAB)
   04151 PI3K-Akt signaling pathway
    107514565 (YWHAB)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107514565 (YWHAB)
   04114 Oocyte meiosis
    107514565 (YWHAB)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107514565 (YWHAB)
  09172 Infectious disease: viral
   05161 Hepatitis B
    107514565 (YWHAB)
   05160 Hepatitis C
    107514565 (YWHAB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ray03400]
    107514565 (YWHAB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107514565 (YWHAB)
DNA repair and recombination proteins [BR:ray03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    107514565 (YWHAB)
Exosome [BR:ray04147]
 Exosomal proteins
  Proteins found in most exosomes
   107514565 (YWHAB)
SSDB
Motif
Pfam: 14-3-3 FliM SF3A2 Peptidase_C98
Other DBs
NCBI-GeneID: 107514565
NCBI-ProteinID: XP_016007891
LinkDB
Position
Unknown
AA seq 246 aa
MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSS
WRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFY
LKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFY
YEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGD
AGEGEN
NT seq 741 nt   +upstreamnt  +downstreamnt
atgaccatggataaaagtgagctggtacagaaagccaaactcgccgagcaggctgagcgc
tatgatgatatggctgcagccatgaaggcagtcacggagcaggggcacgaactctccaat
gaagagagaaatctgctctccgtcgcctataagaacgtggtaggcgcccgccgttcttcc
tggcgtgtcatctccagcattgaacagaaaacagagaggaatgagaagaagcagcagatg
ggcaaagagtaccgcgagaagatcgaggcagagctgcaggacatctgcaatgatgttctg
gagctgttggacaaatatcttattcccaatgctacacaaccagaaagtaaggtgttctac
ttgaaaatgaaaggggattattttagatacctttctgaggtggcatctggagacaataaa
caaaccactgtttcgaactcccagcaggcttaccaggaagcatttgaaattagtaagaaa
gaaatgcagcctacacacccaattcgacttggcctggcgctgaatttctcagtcttttac
tatgagattctgaactctcctgaaaaggcttgcagcttggcaaaaacggcatttgatgaa
gcaattgctgaattggacacgctgaatgaagagtcgtacaaagacagcaccctgatcatg
cagttgcttagggacaatctcactctctggacgtcggaaaaccagggagatgaaggagat
gctggggaaggagagaactaa

DBGET integrated database retrieval system