KEGG   Rousettus aegyptiacus (Egyptian rousette): 107498349
Entry
107498349         CDS       T06036                                 

Gene name
ATP2B2
Definition
(RefSeq) plasma membrane calcium-transporting ATPase 2 isoform X1
  KO
K05850  P-type Ca2+ transporter type 2B [EC:7.2.2.10]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04020  Calcium signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04024  cAMP signaling pathway
ray04261  Adrenergic signaling in cardiomyocytes
ray04925  Aldosterone synthesis and secretion
ray04961  Endocrine and other factor-regulated calcium reabsorption
ray04970  Salivary secretion
ray04972  Pancreatic secretion
ray04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107498349 (ATP2B2)
   04024 cAMP signaling pathway
    107498349 (ATP2B2)
   04022 cGMP-PKG signaling pathway
    107498349 (ATP2B2)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    107498349 (ATP2B2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107498349 (ATP2B2)
  09154 Digestive system
   04970 Salivary secretion
    107498349 (ATP2B2)
   04972 Pancreatic secretion
    107498349 (ATP2B2)
   04978 Mineral absorption
    107498349 (ATP2B2)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    107498349 (ATP2B2)
Enzymes [BR:ray01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     107498349 (ATP2B2)
SSDB
Motif
Pfam: Cation_ATPase_C E1-E2_ATPase ATP_Ca_trans_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3 EMC3_TMCO1
Other DBs
NCBI-GeneID: 107498349
NCBI-ProteinID: XP_015976840
LinkDB
Position
Unknown
AA seq 1243 aa
MGDMTNSDFYSKNQRNESSHGGEFGCTMEELRSLMELRGTEAVVKIKETYGDTEAICRRL
KTSPVEGLPGTAPDLEKRKQIFGQNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIISLG
LSFYHPPGESNEGCATAQGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFR
GLQSRIEQEQKFTVVRASQVVQIPVAEIVVGDIAQIKYGDLLPADGLFIQGNDLKIDESS
LTGESDQVRKSVDKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKD
KKGVKKGDGLQLPAADGAAGSNAADSANASLVNGKMQDGTVDASQSKAKQQDGAAAMEMQ
PLKSAEGGDADDKKKANMHKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFTVDT
FVVNKKPWLPECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNL
VRHLDACETMGNATAICSDKTGTLTTNRMTVVQAYVGDVHYKEIPDPSSINVKTMELLVN
AIAINSAYTTKILPPEKEGALPRQVGNKTECGLLGFVLDLKQDYEPVRSQMPEEKLYKVY
TFNSVRKSMSTVIKLPDESFRMYSKGASEIVLKKCCKILNGSGEPRVFRPRDRDEMVKKV
IEPMACDGLRTICVAYRDFPSSPEPDWDNENDILNDLTCICVVGIEDPVRPEVPEAIRKC
QRAGITVRMVTGDNINTARAIAIKCGIIHPGEDFLCLEGKEFNRRIRNEKGEIEQERIDK
IWPKLRVLARSSPTDKHTLVKGIIDSTHTEQRQVVAVTGDGTNDGPALKKADVGFAMGIA
GTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACIT
QDSPLKAVQMLWVNLIMDTFASLALATEPPTETLLLRKPYGRNKPLISRTMMKNILGHAV
YQLTLIFTLLFVGEKMFQIDSGRNAPLHSPPSEHYTIIFNTFVMMQLFNEINARKIHGER
NVFDGIFRNPIFCTIVLGTFAIQIVIVQFGGKPFSCSPLQLDQWMWCIFIGLGELVWGQV
IATIPTSRLKFLKEAGRLTQKEEIPEEELNEDVEEIDHAERELRRGQILWFRGLNRIQTQ
IRVVKAFRSSLYEGLEKPESRTSIHNFMAHPEFRIEDSQPHIPLIDDTDLEEDAALKQNS
SPPSSLNKNNSAIDSGINLTTDTSKSATSSSPGSPIHSLETSL
NT seq 3732 nt   +upstreamnt  +downstreamnt
atgggtgacatgaccaacagcgacttttactccaaaaaccaaagaaatgagtcgagccat
gggggcgagtttgggtgcacgatggaggagctccgctccctcatggagctgcggggcacc
gaggctgtggtcaagatcaaggagacttatggggacactgaagccatctgtcggcgcctc
aaaacctcacctgtcgaaggtttgccaggcaccgctccagaccttgaaaagagaaaacag
atttttgggcaaaacttcatacctccaaagaagccaaaaaccttcctgcaactcgtgtgg
gaagcgctgcaagatgtgactctgatcatcctggaaattgcggccatcatctccctggga
ctctccttctaccacccgcctggcgagagcaatgaaggatgtgcaacggcccagggcggg
gcagaggatgaaggggaggctgaggcgggctggattgagggggcggccatcctcctctca
gtcatctgtgtggtcctggtcactgctttcaatgactggagcaaagagaagcagttccgg
ggcctgcagagccgcatcgagcaagaacagaagttcaccgtggtccgggctagccaggtg
gtccagatccctgtggctgagattgtggttggagatatcgcccaaattaaatatggtgac
ctcctccctgctgatggtctcttcatccagggcaatgacctcaagattgatgaaagctcc
ttgacaggggagtctgaccaggtgcgcaagtctgtggacaaggaccccatgctgctgtca
ggaacccatgtgatggagggctctggacggatggtggtgacggctgtgggtgtgaactct
cagactggcattatctttaccctgctgggggccggtggcgaagaggaagagaagaaagac
aagaaaggtgtgaagaagggggatggccttcagctaccagcggccgatggtgcggcaggt
tcaaatgctgcagatagtgcaaatgccagcctagtcaatggtaaaatgcaggatggcact
gtggacgccagccagagcaaagcgaaacagcaggatggggcagccgctatggagatgcag
cccctcaagagtgccgagggcggtgacgctgatgacaagaagaaggccaacatgcacaag
aaagagaagtcggtgctccagggcaagctcaccaagctggctgtgcaaattggcaaggca
ggcctggtgatgtcagccatcacagtgatcatcctggtgctctacttcaccgtggacacc
ttcgtggtcaacaagaagccatggctacctgagtgcacgcccgtctacgtgcagtacttt
gtcaagttcttcatcattggcgtgacagtgctggtggttgctgtgcccgaggggctcccc
ctggctgtcaccatctcgctggcctactcagtgaagaaaatgatgaaggacaacaacctg
gtacgccatctggatgcctgtgagaccatgggcaatgccacagccatctgctcagacaag
acgggcacactgaccaccaatcgcatgaccgtggtacaggcctacgttggtgatgtccac
tacaaggagatccctgacccaagctccatcaatgtcaagaccatggagctgctggtcaat
gccatcgccatcaacagcgcctacaccaccaagattctgcccccagagaaggagggcgcc
ctgcctcggcaagtgggtaataagacagagtgtggcctgctgggcttcgtgctggacctg
aagcaggactatgagcccgtgcgcagccagatgccagaggagaagctgtacaaagtatac
accttcaactccgtgcgcaagtccatgagcaccgtcatcaagctgccggatgagagtttc
cgcatgtacagcaagggtgcatctgagatcgtgctcaagaagtgctgcaaaatcctcaat
gggtcaggggagccccgagtcttccggccccgcgaccgggatgagatggtgaagaaggtg
atcgagcccatggcctgcgatgggcttcgcaccatctgcgtggcctaccgtgacttcccc
agcagccctgagcccgactgggacaatgagaacgacatcctgaacgacctcacctgcatc
tgcgtggtgggcatcgaggaccctgtgcggcccgaggtcccagaagccatccgaaagtgc
cagcgggcaggcatcacggtccgcatggtcaccggtgacaatatcaacacagcccgggcc
atcgccataaagtgtggcatcatccatcctggggaggacttcctgtgccttgaaggcaag
gagttcaaccggaggatccgcaacgagaagggggagattgagcaggagcgaatcgacaag
atctggccaaagctgcgggtgctagctcgctcctcccccacggacaagcataccctggtc
aaaggcatcatcgacagcacacacacagagcagcggcaggtggtggccgtgacgggggat
ggcaccaacgatggtcccgcactcaagaaggcagacgtgggcttcgccatgggcattgca
ggtacagatgtggccaaggaggcctcggacatcatcctaacggacgacaatttcagcagc
attgtcaaggcagtgatgtggggccgcaacgtctatgacagcatctccaagttcctgcag
ttccagctgacagtcaacgttgtggccgtgatcgtggccttcacaggagcctgcatcacg
caggactcccctctgaaagccgtgcagatgctctgggtgaacctcatcatggacacattc
gcctcactggcgctggccactgagccaccaactgagaccctgcttctgaggaagccatat
ggccgcaacaagcccctcatctcacggaccatgatgaagaacatcctgggccatgctgtc
taccagctcaccctcatcttcacgctgctcttcgttggcgagaagatgttccagatcgac
agcgggaggaacgcgcccctgcactcgccgccctcggagcactacaccatcatcttcaac
accttcgtcatgatgcagctcttcaacgagatcaatgcccgcaagatccacggcgagcgc
aatgtctttgatggcatcttccggaaccccatcttctgcaccatcgtgctgggcactttt
gccatccagatagtaattgtgcagtttggggggaagccattcagctgctctccactgcag
ctggaccagtggatgtggtgcatattcatcgggttgggagagctcgtctggggccaggtc
attgccaccatcccgaccagcaggctcaagttcctcaaggaagctggcagactcacgcag
aaggaggagatccccgaggaggagctcaacgaggacgtggaagagatagaccacgccgag
cgggagctgaggcggggccagatcctgtggttccgaggcctaaataggatccagacccag
atccgcgtcgtgaaggcgttccgtagctctctctatgaaggtctagaaaagcctgagtct
cgaacctccatccataatttcatggctcatcctgaattccggatcgaagattcacagccc
cacatccccctcattgacgacaccgacctggaagaagatgcggctctcaagcagaactcg
agcccgccgtcatcgctcaacaagaacaacagcgccatcgacagcgggatcaacctgacg
accgacacaagcaaatcagctacctcttcaagtccagggagccccatccacagcctggag
acgtcgctttag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107504061
Entry
107504061         CDS       T06036                                 

Gene name
ATP2B3
Definition
(RefSeq) plasma membrane calcium-transporting ATPase 3 isoform X1
  KO
K05850  P-type Ca2+ transporter type 2B [EC:7.2.2.10]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04020  Calcium signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04024  cAMP signaling pathway
ray04261  Adrenergic signaling in cardiomyocytes
ray04925  Aldosterone synthesis and secretion
ray04961  Endocrine and other factor-regulated calcium reabsorption
ray04970  Salivary secretion
ray04972  Pancreatic secretion
ray04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107504061 (ATP2B3)
   04024 cAMP signaling pathway
    107504061 (ATP2B3)
   04022 cGMP-PKG signaling pathway
    107504061 (ATP2B3)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    107504061 (ATP2B3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107504061 (ATP2B3)
  09154 Digestive system
   04970 Salivary secretion
    107504061 (ATP2B3)
   04972 Pancreatic secretion
    107504061 (ATP2B3)
   04978 Mineral absorption
    107504061 (ATP2B3)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    107504061 (ATP2B3)
Enzymes [BR:ray01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     107504061 (ATP2B3)
SSDB
Motif
Pfam: Cation_ATPase_C E1-E2_ATPase ATP_Ca_trans_C Cation_ATPase Cation_ATPase_N Hydrolase Hydrolase_3
Other DBs
NCBI-GeneID: 107504061
NCBI-ProteinID: XP_015988513
LinkDB
Position
Unknown
AA seq 1249 aa
MGDMANSSIEFHPKPQQQREAPHAGGFGCTLAELRSLMELRGAEALQKIQEAYGDVGGLC
RRLKTSPTEGLADNASDLEKRRQIYGQNFIPPKQPKTFLQLVWEALQDVTLIILEVAAIV
SLGLSFYAPPGEESEVCGNVSAGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEK
QFRGLQSRIEQEQKFTVIRNGQLFQVPVAALVVGDIAQVKYGDLLPADGVLIQGNDLKID
ESSLTGESDHVRKSADKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEE
KKDKKGKQQDGAMESSQTKAKKQDGAVAMEMQPLKSAEGGEMEEREKKKASVPKKEKSVL
QGKLTKLAVQIGKAGLVMSAITVIILVLYFVIETFVIDGRVWLAECTPVYVQYFVKFFII
GVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTT
NRMTVVQSYLGDTHYKEIPAPSALNPKILDLLVHAISINSAYTTKILPPEKEGALPRQVG
NKTECALLGFVLDLKRDFQPVREQIPEDKLYKVYTFNSVRKSMSTVIRTPDGGFRLFSKG
ASEILLKKCTNILNNNGELRGFRPRDRDDMVKKIIEPMACDGLRTICIAYRDFSATQEPD
WDNENEVVGDLTCIAVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAAKCG
IIQPGEDFLCLEGKEFNRRIRNEKGEIEQERLDKVWPKLRVLARSSPTDKHTLVKGIIDS
TTGEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVM
WGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALA
TEPPTESLLLRKPYGRDKPLISRTMMKNILGHAVYQLTIIFTLLFVGELFFDIDSGRNAP
LHSPPSEHYTIIFNTFVMMQLFNEVNARKVHGERNVFHGIFGNPIFCTIVLGTFAIQIVI
VQFGGKPFSCSPLSTEQWLWCLFVGVGELVWGQVIATIPTSQLKCLKEAGHGPGKDEMTD
EELAEGEEEIDHAERELRRGQILWFRGLNRIQTQMEVVSTFKRSGSFQGAMRRRSSVLSQ
LHDIRVVKAFRSSLYEGLEKPESKTSIHNFMATPEFLINDYTHNIPLIDDTDVDENEERL
RAPPPPSPNQNNNAIDSGIYLTTHGTKSATSSVFSSRPGSPIHSVETSL
NT seq 3750 nt   +upstreamnt  +downstreamnt
atgggcgacatggccaacagttccatcgagttccacccgaagccccagcagcagcgggaa
gccccacatgcaggcggctttgggtgcacgctggctgagctgcgctccctcatggagctc
cgaggggccgaggccctgcagaagatccaggaagcctatggggatgtcggtgggctctgc
aggaggctgaagacctcacccacagagggcctagccgacaacgccagcgacttggagaag
cgcaggcagatctacgggcagaacttcatccctcccaagcagcccaagaccttcctgcag
ctggtgtgggaagccctgcaggacgtcacgcttatcatcctggaagtggccgccatcgtc
tccctaggcctctcgttctacgcaccgcccggagaggagagcgaagtgtgcgggaatgtg
tctgctggggcagaagatgaaggtgaggccgaggctggctggatcgagggggcggccatc
ctgctgtctgtcatctgtgtggtgctggtcacggctttcaatgactggagcaaggagaag
cagttccgaggcctgcagagccgtatcgagcaggagcagaagttcacggtcatccggaac
gggcagctctttcaggtccctgtggccgcgctggtagtaggggacattgcccaggtcaag
tatggggacctgctgcctgccgacggcgtgctcatccagggcaatgacctcaagattgat
gagagctccctgactggagagtcggaccacgtgcgcaagtctgctgacaaagaccccatg
ctgctctcaggcactcatgtcatggaaggttctggaagaatggtggtgactgccgttggt
gtgaactcccagacaggcatcatctttaccttgcttggagctggtggagaggaggaggag
aagaaggataagaaaggcaagcagcaggatggggcgatggagagtagccagaccaaagct
aagaagcaagatggggcagttgccatggaaatgcagcccctgaagagtgcggagggtggg
gagatggaggagcgggagaagaagaaagccagcgtgcccaagaaggagaagtcggtcctg
cagggcaagctcaccaagctggctgtgcagatcgggaaagcagggctggtgatgtccgcc
atcaccgtcatcatcctggtcctctactttgtgatcgagaccttcgtcatcgatggccgg
gtgtggctggcggagtgcacgccagtctacgtgcagtactttgtgaagtttttcatcatc
ggtgtcactgtgctggttgtggctgtcccggagggcctgcctctcgctgtcaccatctcc
ctagcttactctgtcaagaaaatgatgaaggacaacaacctggtccgccacctggacgcc
tgtgagacgatgggcaatgccacagccatctgctcagacaagacgggcacgctcaccacc
aatcgtatgaccgtggtccagtcctacctcggggacacccactacaaagagattccggcc
cccagcgccctaaaccccaagatcctcgacctcctggtccacgccatctccatcaacagt
gcctacaccaccaaaatactacctccagagaaggaaggtgccctcccgcgccaagtgggc
aacaagacggagtgcgctctgctgggcttcgtcctggacctgaagcgggacttccagcct
gtgcgggaacagattccagaagataagctttacaaagtgtacaccttcaactcggtccgc
aagtccatgagcacggtcatccgcacgcccgatggcggtttccgcctcttcagcaagggt
gcctcggagatcctgctgaaaaagtgcaccaacatcttaaacaacaatggcgaactacgc
ggcttccgccctcgggaccgggacgacatggtgaagaagatcatcgagccgatggcttgt
gatggcctccgcaccatctgcatcgcctaccgggacttctctgccacccaggagcctgac
tgggacaacgagaatgaagttgtgggcgacctcacctgcatagccgttgtgggcatcgag
gaccccgtgcggcctgaggtccctgaagctatcagaaaatgccagcgtgctggcattaca
gtccgcatggtgaccggggacaatatcaacacagctcgggctatcgcggccaagtgtggc
atcatccagcctggggaggacttcctgtgcctggaggggaaggagttcaaccggaggatc
cgcaacgagaaaggcgagatagaacaggagcgtctggacaaggtgtggcccaagctgaga
gtcctcgcccgatcgtctcccacagacaagcacactctggtcaaagggattattgacagt
accaccggtgagcagcggcaggtggtggccgtgaccggggatggcaccaacgacgggcca
gccctcaaaaaggcagatgtcggcttcgccatgggcatcgcagggactgatgtagccaag
gaggcctcggacatcatcctgactgatgacaacttcaccagcattgtcaaggcggtcatg
tggggccgcaatgtctatgacagcatctccaagttcctgcaattccagctgacggtcaat
gtggtggccgtgatcgtggccttcacaggcgcctgcattactcaggactctcctctcaaa
gccgtgcagatgttgtgggtgaacttgatcatggacacgtttgcctctctggcactggca
acagagccgcccactgagtcactgctgctgcggaagccatatggccgggacaagcccctg
atatcccgaaccatgatgaagaacatcctgggccatgcggtctaccagctcaccatcatc
ttcacactgctatttgtaggggaactcttctttgacatcgacagcgggaggaacgcgccc
ctgcactcgccgccctcggagcactacaccatcatcttcaacacgttcgtcatgatgcag
cttttcaacgaggtcaacgcccgcaaggtccacggtgaacgcaatgtcttccacggcatc
tttggcaaccccatcttctgcaccattgtcctgggcacctttgcaattcagattgtcatc
gtccagtttggtggaaagcccttcagctgctcccccctgtccacggagcagtggctttgg
tgcctatttgttggcgttggggagctggtctggggacaggtcattgccaccattcccacc
agccagctcaagtgcctgaaagaagcagggcacgggcctgggaaggatgagatgaccgac
gaggagctggccgagggggaggaagagattgaccacgccgagcgggagctccgcagaggc
cagatcctctggttccggggcctcaaccggatccagactcagatggaggtagtgagtacc
ttcaagagaagcggttcatttcagggtgccatgcgccggcggtcttcggtcctcagccag
ctccatgacatccgggtggtgaaagcattccgtagctcactctacgaaggcctggagaaa
ccggaatccaagacctccatccataacttcatggcaacgcctgagtttctgatcaatgac
tacacccacaacatcccactcatagatgacacggacgtggatgagaacgaggagcgcctg
cgcgcccctccacccccatcccccaaccagaacaacaacgccatagacagcggcatctac
ctgaccacgcacggcaccaagtcagctacctcgtcagtgttttcttccagacccgggagt
ccgatccacagcgtggagacatccctctaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107508151
Entry
107508151         CDS       T06036                                 

Gene name
ATP2B4
Definition
(RefSeq) LOW QUALITY PROTEIN: plasma membrane calcium-transporting ATPase 4
  KO
K05850  P-type Ca2+ transporter type 2B [EC:7.2.2.10]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04020  Calcium signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04024  cAMP signaling pathway
ray04261  Adrenergic signaling in cardiomyocytes
ray04925  Aldosterone synthesis and secretion
ray04961  Endocrine and other factor-regulated calcium reabsorption
ray04970  Salivary secretion
ray04972  Pancreatic secretion
ray04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107508151 (ATP2B4)
   04024 cAMP signaling pathway
    107508151 (ATP2B4)
   04022 cGMP-PKG signaling pathway
    107508151 (ATP2B4)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    107508151 (ATP2B4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107508151 (ATP2B4)
  09154 Digestive system
   04970 Salivary secretion
    107508151 (ATP2B4)
   04972 Pancreatic secretion
    107508151 (ATP2B4)
   04978 Mineral absorption
    107508151 (ATP2B4)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    107508151 (ATP2B4)
Enzymes [BR:ray01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     107508151 (ATP2B4)
SSDB
Motif
Pfam: Cation_ATPase_C E1-E2_ATPase ATP_Ca_trans_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3
Other DBs
NCBI-GeneID: 107508151
NCBI-ProteinID: XP_015995256
LinkDB
Position
Unknown
AA seq 1206 aa
MTNPTERGLPANSMIESREGDFGCTVMDLRKLMELRSTDAMNQINIHYGGVINLCSRLKT
NPVEGLSGNPADLEKRKQVFGQNLIPPKRPKTFLELVWEALQDVTLIILEIAAIISLVLS
FYRPPGEENEQCGLPVSSPEDEGEAEAGWIEGAAILFSVVIVVLVTAFNDWSKEKQFRGL
QNRIEKEQKFSIIRNGHIIQLPVAEIVVGDIAQIKYGDLLPADGILIQGNDLKIDESSLT
GESDHVKKSVERDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGASEGEEEKKKKG
KKQGVPENRNKAKTQDGVALEIQPLNSQEGLDSEEKEKKAPKLPKKEKSVLQGKLTRLAV
QIGKAGLIMSAITVLILILYFVIDNFVIQRRPWLAECTPIYIQYFVKFFIIGVTVLVVAV
PEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQAF
IGDTRYHQLPSPDALVPKVLDLIVNGISINSAYTSKLLPPEKEGGLPRQVGNKTECALLG
FVTDLKQDYHAVRSEVPEEKLYKVYTFNSVRKSMSTVIQKPSGGYRMYSKGASEIILRKC
NRILDKKGEAIPFKNKDRDEMVRTVIEPMACEGLRTICLAYRDFNDVEPPWDNENEILTE
LTCIAVVGIEDPVRPEVPEAIAKCKRAGITVRMVTGDNINTARAIATKCGIVTPGDDFLC
LEGKEFNRLIRNEKGEVEQEKLDKIWPKLRVLARSSPTDKHTLVKGIIDSTVGEQRQVVA
VTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIS
KFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTDSLLK
RRPYGRNKPLISRTMMKNILGHAVYQLTIIFFLVFAGEKFFDIDSGRNAPLHSPPSQHYT
IVFNTFVLMQLFNEINSRKIHGERNVFAGIFRNLIFCSVVLGTFISQILIVEFGGKPFSC
TSLTLSQWFWCLFIGIGELLWGQVISTIPTQSLKFLKEAGHGTTKEEITKDAEGLDEIDH
AEMELRRGQILWFRGLNRIQTQIKVVKAFHSSLHESIQKPKNQNSIHNFMTHPEFAIDEE
VPRTPLLDEQEEENLEKVSTSGTRVLLLDGDVTPYANKNNNAMCCSQVQIVACHPDSPLH
SLETSV
NT seq 3621 nt   +upstreamnt  +downstreamnt
atgacgaaccctacagaacgtggcttgccggccaattcaatgattgaaagccgtgaagga
gactttggctgcacagtaatggacctgaggaaactcatggagttgcgctcaactgatgca
atgaaccagatcaatatccactatggaggtgtaataaatctctgcagtagactgaaaacc
aaccctgtggaaggcctatctgggaacccggcagatctggagaaacgtaagcaagtgttt
ggacagaacttaatccctcccaaaaggcccaagaccttcttagaattagtgtgggaagcc
cttcaagatgtcacactcatcatcctggagattgcggccataatctccctggtcctgtcc
ttctaccgcccccctggtgaagaaaatgaacagtgtggtctacctgtaagtagcccagaa
gatgaaggggaggcagaagccggctggattgagggggcagccattctattctcagtggtc
atcgtggtgctagtgacagccttcaatgattggagcaaagagaagcagttccggggactg
cagaaccgcattgaaaaggaacagaaattctccatcatccggaacggtcacatcatccag
ctccccgtggctgagattgtggtgggtgatatcgcccagatcaaatatggtgacctgctg
cctgcagatgggatcttgatccaaggtaatgatctcaagatcgacgagagctctctgacg
ggggaatcggaccatgtcaagaaatctgtggaaagagaccccatgttgctctcagggacc
catgtcatggaaggttctggcaggatggtcgtgactgctgtgggtgtcaactcccagact
ggaatcatctttaccctcttaggggccagtgagggagaagaagagaagaagaagaaaggt
aaaaaacaaggagtccctgaaaatcgcaacaaagcaaagactcaggacggtgtagccctg
gaaatccagccactcaacagccaggaggggctcgacagcgaggaaaaggagaaaaaggca
cccaaactgcccaagaaggagaagtcagtgttgcagggcaagctgacgcgcttggccgtt
cagatcgggaaagctggtctgatcatgtccgctatcaccgttctcatcctgattctgtac
ttcgtgattgacaacttcgtgatacagcgcagaccatggctagcagagtgcactcccatt
tacatccagtactttgtcaagttcttcatcattggcgtcaccgtactggtggtagctgtg
ccagaggggctgccactggctgtcaccatctcactcgcctactctgtgaagaaaatgatg
aaagacaataacctggtacggcatctggatgcttgtgagacaatgggcaacgccacagcc
atttgctctgacaagacaggcacattgaccatgaaccgcatgacagtggtacaggctttt
atcggagacacccgttaccatcagctcccaagtcctgatgcccttgtgcccaaggtcctg
gaccttattgtcaatggcatttctatcaacagtgcctatacctccaagctcctgccaccg
gagaaggagggaggcctgccacgtcaggtgggcaacaagacagagtgtgcgctgctgggc
tttgtcactgacctgaagcaggactaccatgcggtgcgcagtgaggtgcctgaggagaag
ctctacaaggtgtacaccttcaactcggtgcgcaagtccatgagcacagtcatccagaag
cccagcggcggctaccgcatgtacagcaagggcgcctccgagatcatcttgcgcaagtgc
aatcgaatcctggacaagaaaggggaagcaataccattcaaaaataaggaccgagatgag
atggtacgcactgtcattgagcccatggcctgtgagggactccggaccatctgcttagct
taccgagatttcaatgacgtggagcccccgtgggacaatgagaacgagatcctgactgaa
ctgacctgtatcgcagtggtgggcattgaggaccccgtgcgtccagaggtcccagaagct
attgccaaatgcaaacgagccggcattactgtcagaatggtgacgggagacaacatcaac
acagcccgggctatcgccaccaaatgtggcattgtgacacctggggatgacttcttgtgc
ttagaaggcaaagaattcaaccgactcattcgcaacgagaagggcgaggtggagcaagaa
aaactggacaagatttggcctaaacttcgagtcctggcacgatcttcccccacggacaag
catacactggtgaaaggcatcattgacagcaccgttggggagcagcgacaggtggtggct
gtcactggtgatggcacaaatgatgggccagccctgaagaaagcagatgttggttttgcc
atgggtattgcaggcacagatgtggcaaaagaggcatcagacatcatcctaacagacgac
aattttaccagcattgtgaaggctgtgatgtggggacgaaacgtctatgacagcatctcc
aagttcctgcagttccagctcactgtcaatgtggtggccgtgattgtggcctttactgga
gcctgcatcactcaggattccccactgaaagccgtgcagatgctgtgggttaatctaatc
atggacacgttcgcctcgttggccctggccacagagcctcctacagattctctgttgaaa
cgtcgcccctatggccgaaataagcctctgatctcacggactatgatgaagaacatcttg
ggacacgcggtctatcagctcacaattatctttttccttgtctttgccggtgagaaattc
tttgacattgatagtgggaggaacgcacctctacattccccacccagccagcactatacc
attgttttcaacaccttcgtactgatgcagctcttcaatgaaatcaactcgcgcaagatc
catggggagaggaacgtctttgcgggcatcttccgcaatctcatcttctgttctgtggtc
ttgggcacattcatcagccagattctcattgtggaatttgggggtaaaccctttagttgt
acgagtctcaccctgtcccagtggttttggtgtctcttcattggcattggagaactgctg
tggggccaggtaatctccacgatacctacccaatccctgaagttcctaaaggaggctggg
catggcaccaccaaagaagagatcaccaaggatgcagagggcctggatgagattgaccat
gcagagatggagctgcgccggggccagatcctgtggttccggggcctgaaccgtattcag
actcagatcaaagtagtcaaagcattccatagttccctccatgaaagcatccagaaaccc
aagaaccaaaactccatccacaacttcatgacccaccctgaattcgccatagatgaggag
gtgccacgaacaccactcctggatgagcaagaggaggaaaatctcgaaaaggtttctacg
tctggaactagggtgctactgttggatggtgatgtcactccgtatgccaacaaaaacaac
aatgcgatgtgttgtagccaggtgcaaattgttgcctgccacccggacagccctctgcac
agcctggagacatcagtttga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107520906
Entry
107520906         CDS       T06036                                 

Gene name
ATP2B1
Definition
(RefSeq) plasma membrane calcium-transporting ATPase 1 isoform X1
  KO
K05850  P-type Ca2+ transporter type 2B [EC:7.2.2.10]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04020  Calcium signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04024  cAMP signaling pathway
ray04261  Adrenergic signaling in cardiomyocytes
ray04925  Aldosterone synthesis and secretion
ray04961  Endocrine and other factor-regulated calcium reabsorption
ray04970  Salivary secretion
ray04972  Pancreatic secretion
ray04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107520906 (ATP2B1)
   04024 cAMP signaling pathway
    107520906 (ATP2B1)
   04022 cGMP-PKG signaling pathway
    107520906 (ATP2B1)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    107520906 (ATP2B1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107520906 (ATP2B1)
  09154 Digestive system
   04970 Salivary secretion
    107520906 (ATP2B1)
   04972 Pancreatic secretion
    107520906 (ATP2B1)
   04978 Mineral absorption
    107520906 (ATP2B1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    107520906 (ATP2B1)
Enzymes [BR:ray01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     107520906 (ATP2B1)
SSDB
Motif
Pfam: Cation_ATPase_C E1-E2_ATPase ATP_Ca_trans_C Cation_ATPase Cation_ATPase_N Hydrolase Hydrolase_3
Other DBs
NCBI-GeneID: 107520906
NCBI-ProteinID: XP_016020629
LinkDB
Position
Unknown
AA seq 1270 aa
MGDMANNSVSYSGVKNSLKEANHDGDFGITLAELRALMELRSTDALRKIQESYGDVYGIC
TRLKTSPNEGLSGNPADIERREAVFGKNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIV
SLGLSFYQPPEGDNALCGEVSVGEEEGEGETGWIEGAAILLSVVCVVLVTAFNDWSKEKQ
FRGLQSRIEQEQKFTVIRGGQVIQIPVADITVGDIAQVKYGDLLPADGILIQGNDLKIDE
SSLTGESDHVKKSLDKDPLLLSGTHVMEGSGRMVVTAVGINSQTGIIFTLLGAGGEEEEK
KDEKKKEKKKRETIFPSVDFQPSSQSKAVQDKKQDGAIENRNKAKAQDGAAMEMQPLKSE
EGGDGDEKDKKKANLPKKEKSVLQGKLTKLAVQIGKAGLLMSAITVIILVLYFVIDTFWV
QKRPWLAECTPIYIQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRH
LDACETMGNATAICSDKTGTLTMNRMTVVQAYINEKHYKKVPEPEAIPPNILSYLVTGIS
VNCAYTSKILPPEKEGGLPRHVGNKTECALLGFLLDLKRDYQDVRNEIPEEALYKVYTFN
SVRKSMSTVLKNSDGSYRIFSKGASEIILKKCFKILSANGEAKVFRPRDRDDIVKTVIEP
MASEGLRTICLAFRDFPAGEPEPEWDNENDIVTGLTCIAVVGIEDPVRPEVPDAIKKCQR
AGITVRMVTGDNINTARAIATKCGILHPGEDFLCLEGKDFNRRIRNEKGEIEQERIDKIW
PKLRVLARSSPTDKHTLVKGIIDSTVSDQRQVVAVTGDGTNDGPALKKADVGFAMGIAGT
DVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQD
SPLKAVQMLWVNLIMDTLASLALATEPPTESLLLRKPYGRNKPLISRTMMKNILGHAFYQ
LVVVFTLLFAGEKFFDIDSGRNAPLHAPPSEHYTIVFNTFVLMQLFNEINARKIHGERNV
FEGIFNNAIFCTIVLGTFVVQIIIVQFGGKPFSCSELSIEQWLWSIFLGMGTLLWGQLIS
TIPTSRLKFLKEAGHGTQKEEIPEEELAEDVEEIDHAERELRRGQILWFRGLNRIQTQMD
VVNAFQSGSSIQGALRRQPSIASQHHDIRVVNAFRSSLYEGLEKPESRSSIHNFMTHPEF
RIEDSEPHIPLIDDTDAEDDAPTKRNSSPPPSPNKNNNAVDSGIYLTIEMNKSATSSSPG
SPLHSLETSL
NT seq 3813 nt   +upstreamnt  +downstreamnt
atgggcgacatggcaaacaactcagtttcatatagtggagtaaaaaactctttgaaggaa
gctaatcatgatggagactttggaattacgctcgcagaactgcgggctctcatggagctc
aggtctacagatgcattacgaaaaatacaggaaagctatggagatgtctatggaatttgc
accaggttgaaaacatctccaaatgaaggtttaagtggaaaccctgcagatatagaaaga
agagaagcagtgtttggaaagaattttatacctcctaaaaagccaaaaacctttctccaa
ttagtatgggaagcattacaagatgtcactttaattatattagaaattgcagccatagta
tcactgggcctttctttttatcaacctccagaaggagataatgcactttgtggagaagtt
tccgttggagaggaagaaggtgaaggtgaaacgggctggattgaaggagctgcgatcctc
ttgtcagtagtgtgtgtggtgttagtaacagcattcaatgactggagtaaggaaaaacag
tttagaggtttgcagagtcgaattgaacaagaacagaagtttacagtcatcaggggtggt
caggtcattcagatacctgtagctgacattactgttggagatattgcgcaagtgaaatat
ggtgatcttcttccagctgatggtatacttattcaaggcaatgatcttaaaattgatgaa
agttcattgactggtgaatctgatcatgttaagaagtctttagataaagatcccttactt
ctatcaggtactcatgtaatggaaggctctggaagaatggtagtcactgctgtaggtata
aattctcaaactggaattatctttaccttgcttggagctggaggtgaagaggaagagaag
aaagatgagaagaaaaaagaaaagaaaaaacgggagaccatttttccgtctgtggacttc
cagccctcctctcagtcaaaagcagtccaggataagaaacaagatggagctattgagaat
cgcaacaaagcaaaagcccaagatggtgcagctatggaaatgcagcctttgaagagtgaa
gaaggtggagatggtgacgaaaaagacaaaaagaaagcaaatttgccaaaaaaggaaaaa
tccgttttacaagggaaacttacgaagctggctgttcagattggcaaagcgggtttgttg
atgtctgccatcacagttatcattctagtattatattttgtaattgatacattctgggtt
cagaagagaccatggcttgccgagtgcacacctatttacatacaatattttgtgaagttc
ttcattattggagttacagttttagtggtagctgtgccggaaggtcttccacttgcagtc
actatttccctggcttattcagtcaagaaaatgatgaaagataataacctagtaaggcat
ctggatgcttgtgaaaccatgggaaatgctacagccatttgttcagataaaacaggaacg
ttgacaatgaacagaatgacagttgttcaagcttacataaatgaaaagcattataaaaag
gtccctgaaccagaagctattccaccaaatatcttgtcctatcttgtaacaggaatttct
gtgaattgtgcttatacatcaaaaatactgccaccagagaaagagggtggattacctcgt
catgttggtaataaaactgaatgtgccttgttgggatttcttttggacttaaaacgggat
tatcaggatgttagaaatgaaataccggaagaagcactgtacaaagtctacaccttcaat
tctgttaggaagtccatgagtactgtcctgaaaaattcagatggaagctatcgaatattc
agcaagggtgcatctgagataattctgaaaaagtgtttcaaaatcttgagtgctaatggt
gaggcaaaagtgttcagaccaagggaccgtgatgatattgtaaaaactgtgattgaaccg
atggcatcagaaggcttgagaaccatatgtcttgcattcagagatttcccagcaggagaa
ccagaaccagagtgggataatgaaaatgatattgtcaccggccttacatgcattgctgtt
gtggggattgaagatcctgtgagacctgaggtaccagatgcaataaagaaatgccagcgg
gctggaattactgtgcggatggtcactggtgataatattaatactgctcgggctattgct
accaaatgtggtattttacatcctggggaagatttcctgtgccttgaaggtaaagatttc
aacaggagaatacgaaatgaaaaaggagagattgagcaagagcggatagacaagatttgg
ccaaagcttcgagtacttgcaagatcatctcctactgacaaacatacactggttaaaggt
ataattgacagcactgtctcagatcaacgtcaggttgtagctgtaacaggtgatggtaca
aatgatggtccggcactaaagaaagctgacgttggatttgcaatgggcatcgctggaact
gatgtagctaaagaagcatctgatatcattctcacagatgacaactttacgagcattgtt
aaagcagttatgtggggacgaaatgtctatgacagcatctcaaaattccttcagttccag
cttaccgttaatgtagtagcagtgattgttgctttcacgggcgcctgtattactcaagat
tcgccgcttaaggctgtgcagatgctgtgggtaaacctcataatggatacactcgcttcc
ctggctctggcaactgaaccccccactgaatctctcttgcttcggaaaccttatggtaga
aataagcctctcatctcacgcaccatgatgaagaatattttgggtcatgcgttctatcaa
cttgtagtagtctttacactcttgtttgctggagaaaagttttttgatattgatagtgga
agaaacgctcctttgcatgctcctccttcggaacattacactattgtttttaataccttt
gtgctgatgcaacttttcaacgaaataaatgcccggaaaattcatggtgaaagaaatgtg
tttgaaggaatctttaataatgccatcttctgcacaattgttttaggcacttttgtggta
cagataataattgtgcagtttggtggaaaacctttcagttgttcagaactatcaatagaa
cagtggctgtggtcaatattcctgggaatgggaacgttactctggggccagctaatttca
acaattccaactagccgtttaaaattcctaaaagaagctggtcatggaacacaaaaggaa
gaaatacctgaggaagagttagcagaagacgtggaggagattgatcatgctgaaagggag
ttacgacgtggccagatcctatggtttagaggtctgaacagaatccaaacacagatggat
gtagtgaatgctttccagagtggaagttccattcagggggctctaaggcggcaaccctcc
atcgccagccagcatcatgatattcgagtggtgaatgcatttcgtagttctttatatgaa
gggttagaaaaaccggaatcaagaagttcgattcacaactttatgacacatcctgagttt
aggatagaagattcagagcctcacatcccccttattgatgacactgatgctgaagatgat
gctcctacaaaacgtaactccagtcctccaccctctcccaacaaaaataacaatgctgtt
gacagcgggatttaccttacaatagaaatgaacaagtctgctacctcttcatccccagga
agcccactacacagtttggaaacatcactctga

DBGET integrated database retrieval system