KEGG   Rousettus aegyptiacus (Egyptian rousette): 107498353
Entry
107498353         CDS       T06036                                 

Gene name
GHRL
Definition
(RefSeq) appetite-regulating hormone
  KO
K05254  ghrelin
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04024  cAMP signaling pathway
ray04080  Neuroactive ligand-receptor interaction
ray04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107498353 (GHRL)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107498353 (GHRL)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    107498353 (GHRL)
SSDB
Motif
Pfam: Motilin_assoc Motilin_ghrelin
Other DBs
NCBI-GeneID: 107498353
NCBI-ProteinID: XP_015976856
LinkDB
Position
Unknown
AA seq 117 aa
MPSLGALCSLLLLSVLWVDLAMAGSSFLSPEHQKVQQRKGSKKPPVKLQPRELKGWLHPE
DGSQAEGAEDELKIRFNTPFDVGIKLSGAQDRRPGQVLEKFLQDVLWEEASEALADK
NT seq 354 nt   +upstreamnt  +downstreamnt
atgccctccctgggagctctctgcagcctgctgctcctcagtgtgctctgggtagacttg
gccatggcaggctccagcttcctgagtcccgaacaccagaaagtacagcagagaaagggg
tccaagaagccaccagtcaaactacaacctcgagagctcaaaggctggctccacccagaa
gatggaagtcaggcagaaggggcagaggatgagctgaaaatccggttcaacacccccttt
gatgttggaatcaagctgtcaggggctcaggaccgccgtcctggtcaggtcctggagaag
tttcttcaggatgtcctttgggaagaggccagtgaggccctggcagacaagtga

DBGET integrated database retrieval system