KEGG   Rousettus aegyptiacus (Egyptian rousette): 107498359
Entry
107498359         CDS       T06036                                 

Gene name
SLC6A11
Definition
(RefSeq) sodium- and chloride-dependent GABA transporter 3
  KO
K05044  solute carrier family 6 (neurotransmitter transporter, GABA) member 11
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04721  Synaptic vesicle cycle
ray04727  GABAergic synapse
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107498359 (SLC6A11)
   04721 Synaptic vesicle cycle
    107498359 (SLC6A11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ray02000]
    107498359 (SLC6A11)
Transporters [BR:ray02000]
 Solute carrier family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   107498359 (SLC6A11)
SSDB
Motif
Pfam: SNF
Other DBs
NCBI-GeneID: 107498359
NCBI-ProteinID: XP_015976866
LinkDB
Position
Unknown
AA seq 629 aa
MTAEKALPLGNGKAAEEAQESEAPGGGGGAAPARDPRDKRDKAVHERGHWNNKVEFVLSV
AGEIIGLGNVWRFPYLCYKNGGGAFLIPYVVFFICCGIPVFFLETALGQFTSEGGITCWR
KVCPLFEGIGYATQVIEAHLNVYYIIILAWAIFYLSNCFTTELPWATCGHEWNTENCVEF
QKLNVSNHSHVSLQNATSPVMEFWERRVLAISDGIEHIGNLRWELALCLLAAWTICYFCI
WKGTKSTGKVVYVTATFPYVMLLILLIRGVTLPGASEGIKFYLYPDLSRLSDPQVWVDAG
TQIFFSYAICLGCLTALGSYNNYNNNCYRDCIMLCCLNSGTSFVAGFAIFSVLGFMAYEQ
GVPIAEVAESGPGLAFIAYPKAVTMMPLSPLWATLFFMMLIFLGLDSQFVCVESLVTAVV
DMYPKVFRRGYRRELLILALSIVSYFLGLVMLTEGGMYIFQLFDSYAASGMCLLFVAIFE
CICIGWVYGSNRFYDNIEDMIGYRPLSLIKWCWKVVTPGICAGIFIFFLVKYKPLKYNNI
YTYPAWGYGIGWLMALSSMLCIPLWIFIKVWKTEGKLLEKFRKLTIPSADLKMRGKLGAG
PRTVMVNDCDAKLKGDGTIAAITEKETHF
NT seq 1890 nt   +upstreamnt  +downstreamnt
atgacggcggagaaggcgctgcctctgggtaacgggaaggctgccgaggaggcgcaggag
tccgaagcgccgggcggcggcgggggcgcggcgcccgcgcgcgacccgcgcgacaagcgc
gacaaggcggtccacgagcgcggccactggaacaacaaggtggagttcgtgctgagcgtg
gccggggagattatcgggcttggtaacgtgtggcgcttcccttacctgtgctacaagaac
ggaggaggggcgttcctgattccctatgtggtattttttatttgctgtggaattcctgtt
tttttcctggaaacagctctgggacaattcacaagtgaaggtggaattacatgttggaga
aaagtttgccctttatttgaaggcattggctatgcaacacaggtgatcgaggcccatcta
aatgtgtactacattatcatcttggcgtgggccattttctacctgagcaactgctttacc
acggagctcccctgggccacctgtgggcatgagtggaacacagagaactgtgtggagttc
cagaaactgaatgtgagcaaccacagccatgtgtccctgcagaacgccacctctcccgtc
atggagttttgggagcgccgggttctggccatctcagatgggattgagcacattgggaac
ctccgctgggagctggctttgtgtctcctggcagcctggaccatctgctacttctgtatc
tggaaggggaccaagtccacaggaaaggttgtatacgtcactgcgacattcccctatgtc
atgcttctgatcctcctgatccgaggggtcacgttgcctggggcctctgaaggcatcaag
ttctacctgtaccctgacctctctcggctctccgacccacaggtctgggtagatgctgga
acacagatctttttctcctatgccatctgcctgggttgcctgactgctctgggaagttat
aacaattataacaacaactgctacagggactgtattatgctctgctgtctgaacagtggc
accagctttgtggccggctttgccatcttctctgtcctgggcttcatggcatacgaacag
ggggtacccattgctgaggtagcagagtcaggcccaggcctggcctttattgcctacccc
aaggctgtcaccatgatgcctctgtccccactgtgggccaccttgttcttcatgatgctc
atcttcctgggcctggacagccagtttgtgtgcgtggaaagcctcgtgactgctgtggtg
gacatgtaccccaaggtctttcggaggggctatcggcgggagctgctcatcctggccctg
tcgatcgtctcctattttctgggcctcgtgatgttaacagagggcggcatgtacatcttc
cagctcttcgactcctatgccgccagtgggatgtgccttctcttcgtggccatctttgag
tgcatctgcatcggctgggtgtacggaagcaaccgcttctatgataacatcgaagacatg
attggctaccgaccattgtcgctcattaaatggtgctggaaggttgtgacccccgggatc
tgtgcgggcattttcatcttcttcctggtcaagtacaagcctctcaagtacaacaacatc
tacacttacccagcctggggctatggcattggctggctcatggccctgtcctctatgctc
tgcatccccctctggatcttcatcaaggtgtggaagacagaggggaagctgctggagaaa
ttccggaagttgacgatccccagcgctgacctgaaaatgcggggcaagcttggggcaggc
ccacggacggtgatggttaatgactgtgacgccaaactcaagggcgatgggaccattgca
gccatcacagagaaggagacgcacttctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107498365
Entry
107498365         CDS       T06036                                 

Gene name
SLC6A1
Definition
(RefSeq) sodium- and chloride-dependent GABA transporter 1
  KO
K05034  solute carrier family 6 (neurotransmitter transporter, GABA) member 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04721  Synaptic vesicle cycle
ray04727  GABAergic synapse
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107498365 (SLC6A1)
   04721 Synaptic vesicle cycle
    107498365 (SLC6A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ray02000]
    107498365 (SLC6A1)
Transporters [BR:ray02000]
 Solute carrier family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   107498365 (SLC6A1)
SSDB
Motif
Pfam: SNF
Other DBs
NCBI-GeneID: 107498365
NCBI-ProteinID: XP_015976876
LinkDB
Position
Unknown
AA seq 599 aa
MATNGSKVADGQISTEVSEVPVANDKPKTLVVKVQKKAADLPDRDTWKGRFDFLMSCVGY
AIGLGNVWRFPYLCGKNGGGAFLIPYFLTLIFAGVPLFLLECSLGQYTSIGGLGVWKLAP
MFKGVGLAAAVLSFWLNIYYIVIISWAIYYLYNSFTTTLPWKQCDNPWNTDRCFSNYSIV
NTTNMTSAVVEFWEHNMHQMTDGLDKPGQIRWPLAITLAIAWILVYFCIWKGVGWTGKVV
YFSATYPYIMLIILFFRGVTLPGAKEGILFYITPNFRKLSDSEVWLDAATQIFFSYGLGL
GSLIALGSYNSFHNNVYRDSIIVCCINSCTSMFAGFVIFSIVGFMAHVTKRSIADVAASG
PGLAFLAYPEAVTQLPISPLWAVLFFSMLLMLGIDSQFCTVEGFITALVDEYPRLLRNRR
ELFIAAVCVVSYLIGLSNITQGGIYVFKLFDYYSASGMSLLFLVFFECVSISWFYGVNRF
YDNIQEMVGSRPCIWWKLCWSFFTPIIVAGVFIFSAVQMTPLTMGSYVFPKWGQGVGWLM
ALSSMVLIPGYMAYMFLTLKGSLKQRIQVMIQPSEDIVRPENGPEQPQASGSASKEAYI
NT seq 1800 nt   +upstreamnt  +downstreamnt
atggcgaccaatggcagcaaggtggccgatgggcagatctccacggaggtcagcgaggtc
cctgtggccaatgacaaacccaaaaccctggtggtcaaggtgcagaagaaggcagcggac
cttccagacagggacacatggaagggccgctttgacttcctcatgtcctgcgtgggctac
gccatcggcctgggcaacgtctggagattcccctatctctgtggaaaaaatggcggcggg
gccttcctgatcccctacttcctgacgctcatctttgcgggggtcccgctcttcctgctg
gagtgctctctaggccagtacacgtccattgggggtctgggggtctggaagctggcccct
atgttcaagggtgtgggccttgctgctgctgtgttgtccttctggctgaacatctactac
attgtcatcatctcctgggccatctactacctgtacaattccttcaccacgacgcttcca
tggaaacagtgtgacaacccctggaacacagaccgctgcttctccaactacagcattgtg
aacactaccaacatgaccagtgccgtggtggagttctgggagcacaacatgcatcagatg
acagacgggctggataagccgggtcagatccgctggcctctggccatcaccctggccatc
gcttggatccttgtgtatttctgtatctggaagggtgttggctggactggaaaggtggtc
tacttctctgccacctatccctacatcatgctgattatcctgttcttccgaggagtgacg
ctgcctggtgccaaggaaggcatcctcttctacatcacacccaacttccgcaagctgtca
gactccgaggtgtggctggatgctgctacccagatcttcttctcctatggactgggtctg
ggatccctgattgctcttgggagctacaactctttccacaacaacgtctatagggactcc
atcattgtctgctgcatcaattcgtgcaccagcatgttcgcaggatttgtcatcttctcc
atcgtgggcttcatggcccatgtcaccaaaaggtccattgctgatgtggcagcctcaggc
cctgggctggcattcctggcatacccggaggcagtgacccagctgcccatctcgcccctc
tgggccgtcctcttcttctcgatgctgctgatgctgggcattgacagccagttctgcact
gtggagggcttcatcacggccctggtggatgagtaccctagacttctccgcaatcgcagg
gagctcttcattgctgccgtctgtgtggtctcctacctgattggcctctctaacatcacc
cagggtggcatttatgtcttcaagctgttcgattactattctgccagtggcatgagcctt
ctgttcctcgtgttcttcgaatgtgtctccatttcctggttttacggtgtcaaccgattc
tatgacaacatccaagagatggttggctccaggccctgcatctggtggaagctctgctgg
tccttcttcactccaatcattgtggcgggcgtgttcattttcagtgctgtgcagatgact
cctctcaccatgggaagctatgttttccccaagtggggccagggcgtgggctggctcatg
gctctgtcttctatggttctcattcccggatacatggcctacatgttcctcaccttaaag
ggctccctgaaacagcgcatccaggtcatgatccagcccagcgaagacatcgttcgccca
gagaacggtccagagcagccccaggccagtggctcagctagcaaagaggcctacatctag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107509756
Entry
107509756         CDS       T06036                                 

Gene name
SLC6A12
Definition
(RefSeq) sodium- and chloride-dependent betaine transporter isoform X1
  KO
K05045  solute carrier family 6 (neurotransmitter transporter, betaine/GABA) member 12
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04721  Synaptic vesicle cycle
ray04727  GABAergic synapse
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107509756 (SLC6A12)
   04721 Synaptic vesicle cycle
    107509756 (SLC6A12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ray02000]
    107509756 (SLC6A12)
Transporters [BR:ray02000]
 Solute carrier family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   107509756 (SLC6A12)
SSDB
Motif
Pfam: SNF
Other DBs
NCBI-GeneID: 107509756
NCBI-ProteinID: XP_015998016
LinkDB
Position
Unknown
AA seq 657 aa
MPQRPSEARSCGWVLPSAAWTPPPGSSLEAEAELSGLPIHYVTMDRKVAVHEDGPPVVFW
FPEKGEKLDQEGKDQVKDRGQWTNKMEFVLSVAGEIIGLGNVWRFPYLCYKNGGGAFFIP
YFIFFFACGIPVFFLEVALGQYTSQGSATAWRKICPLLQGIGVASVVIEAYMNIYYIIIL
AWALFYLFNSFTSELPWTTCSNTWNTEHCMDFLNRSGANKVMPSENFTSPVMEFWERRVL
GITSGIHDLGALRWELALCLLLAWVVCYFCIWKGVKTTGKVVYFTATFPYLMLIILLIRG
VTLPGAYEGIIYYLKPDLSRLKDSQVWMDAGTQIFFSFAICQGCLTALGSYNKYHNNCYK
DSIALCFLNSATSFAAGFVVFSILGFMSQEQGVPISEVAESGPGLAFIAFPKAVTMMPLS
QLWSCLFFIMLIFLGLDSQFVCVECLVTASMDMFPRQLRKSGRRELLILAVAVICYLIGL
FLVTEGGMYIFQLFDYYASSGICLLFLSMFEVICIGWVYGADRFYDNIEDMIGYRPWPLV
KISWLFLTPGLCLATFFFSLSKYAPLKYNNIYVYPPWGYFIGWFLALSSMACVPLFIIIT
LLKTQGSFKKRLRQLITPDPSLPQPKQHLCLDGGTTQNCGPSPVKEGLIVGEKETHL
NT seq 1974 nt   +upstreamnt  +downstreamnt
atgccccaacgcccttctgaggcgaggagttgtgggtgggtgcttccctctgcagcctgg
acaccccctcctggcagctcactggaagcagaggcagagctcagtggcctcccaatccat
tacgtgactatggacagaaaagtggcagtccatgaagatgggcctcctgtggtcttctgg
ttccctgagaagggagagaagttggaccaggaaggcaaggaccaggtgaaggatcggggc
caatggaccaacaagatggagtttgtgctgtcagtggccggggagatcattgggctgggc
aatgtctggaggtttccctatctctgctacaaaaatggaggtggagccttcttcatcccc
tacttcatcttcttcttcgcctgtggcatcccggtgttcttcctggaggtggcattgggc
cagtacaccagccaagggagcgccacagcttggaggaagatctgccccctcctccagggc
attggcgtggcatctgtggtcattgaggcctatatgaacatctactacatcatcatcctc
gcctgggccctcttctatctgttcaactcctttacctctgagctgccttggacgacttgt
agcaatacctggaacacagaacattgcatggactttctgaaccgctctggagctaacaaa
gtgatgccttctgagaacttcacctcacctgtcatggaattctgggagagacgtgttttg
ggcattacctcaggtatccatgacctgggggccttgcgctgggagctggccctgtgcctc
ctgcttgcctgggtcgtctgctacttctgcatctggaagggggtcaagaccacagggaag
gttgtttatttcacagccacatttccctacctgatgctgatcatcctgttgatccgaggc
gtcacactccctggagcatatgagggcatcatctattatctgaagccagatttgtctcgc
ctgaaggactcccaggtgtggatggatgcgggcacccagatcttcttctcctttgccatc
tgccagggatgcctgacggccttgggcagctacaacaagtaccacaacaactgctacaag
gacagcatcgccctctgcttcctgaacagtgccaccagctttgcggctggatttgtggtc
ttctctatcctgggcttcatgtcccaagagcaaggggtgcccatctctgaagtggccgaa
tcaggtcctggtctggccttcatcgcatttcctaaggctgtgactatgatgcccttatcc
cagctgtggtcctgcctcttcttcattatgctcatcttcctagggctggacagccagttt
gtttgcgtggagtgcctggtgacagcctccatggacatgttccccaggcagctccggaag
agcgggcggcgagagctcctcatcctcgctgttgctgtcatatgctacctgattgggctt
ttcctggtcactgagggcgggatgtatatcttccagctgtttgattattatgcttccagt
ggcatatgcctgctcttcctctcaatgtttgaagtaatctgcatcggctgggtgtatggg
gcagaccgtttctatgacaacatcgaggacatgattggctaccggccatggcccctggtg
aagatctcctggctcttcctgacccctgggctttgcctggccactttcttcttctccttg
agcaagtatgcacctctcaagtacaacaacatctatgtgtaccctccctggggatacttc
attggctggttcctggctctctcctccatggcctgtgttcccctcttcatcatcatcacc
ctcctgaagacccagggttccttcaagaagcgcctgcgacagctcatcacccctgacccc
agcctaccacagcccaagcaacatctatgtctggatggaggcaccacccagaactgtggg
ccctccccagtgaaggagggactgatagttggggagaaagagacccacttgtag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107509787
Entry
107509787         CDS       T06036                                 

Gene name
SLC6A13
Definition
(RefSeq) sodium- and chloride-dependent GABA transporter 2 isoform X1
  KO
K05046  solute carrier family 6 (neurotransmitter transporter, GABA) member 13
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04721  Synaptic vesicle cycle
ray04727  GABAergic synapse
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107509787 (SLC6A13)
   04721 Synaptic vesicle cycle
    107509787 (SLC6A13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ray02000]
    107509787 (SLC6A13)
Transporters [BR:ray02000]
 Solute carrier family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   107509787 (SLC6A13)
SSDB
Motif
Pfam: SNF
Other DBs
NCBI-GeneID: 107509787
NCBI-ProteinID: XP_015998070
LinkDB
Position
Unknown
AA seq 602 aa
MDSRVLRTTSNGETKPVYPVMEKAEEDGTLERGHWNNKMEFVLSVAGEIIGLGNVWRFPY
LCYKNGGGAFFIPYLIFLFTCGIPVFLLETALGQYTSQGGVTAWRKICPIFEGIGYASQM
IVILLNIYYIIVLAWALFYLFSSFTIDLPWGSCRNEWNTEHCVEFQRINGSLNVTSENAT
SPVIEFWERRVLKISDGIQHLGALRWELVLCLLLAWVICYFCIWKGVKSTGKVVYFTATF
PYLMLVVLLIRGVTLPGAAQGIQFYLYPNLTRLRDPQVWMDAGTQIFFSFAICLGCLTAL
GSYNKYHNNCYRDCMALCFLNSGTSFVAGFAIFSILGFMSQEQGVPISEVAESGPGLAFI
AYPRAVVMLPFSPLWACCFFFMVVLLGLDSQFVCVESLVTALVDMYPHVFRKKNRREVLI
LGVSVTSFLLGLIMLTEGGMYVFQLFDYYAASGMCLLFVAIFESLCVAWVYGAGRFYDNI
EDMIGYRPWPLIKYCWLFLTPAVCTATFLFSLIKYTPLTYNKKYTYPWWGDALGWLLALS
SMVCIPAWSFYKLSALKGSFRERIRQLVCPAEDLTQRDRAGPSASAAPRTALLRPTELES
HC
NT seq 1809 nt   +upstreamnt  +downstreamnt
atggatagcagggtcttgcgcacaaccagtaatggagagacaaagccagtgtacccagtc
atggaaaaggcggaggaagatggcaccctggaacgagggcactggaacaacaagatggag
tttgtgttgtccgtggccggggagatcattggtctaggcaacgtctggaggtttccctat
ctctgctacaaaaatgggggaggtgcctttttcatcccctacctcatcttcctctttacc
tgtggtattcctgtcttccttttggagacagcactgggccagtacactagccagggcggt
gtcacagcctggaggaagatctgccccatctttgagggcatcggctatgcctctcagatg
atcgtcatcctcctcaacatctactacatcatcgttctggcctgggccctcttctacctc
tttagcagcttcactatcgacctcccctggggaagctgccgcaatgagtggaatacagaa
cactgtgtggagttccagaggatcaatggctccctgaatgtgacctctgagaatgccacc
tctcctgtcatcgagttctgggagaggcgggtcctgaagatctctgatggcatccagcac
ctgggggccctgcgctgggaactggttttatgtctcctgcttgcctgggtcatctgctac
ttctgcatctggaagggggtcaagtccacgggcaaggtggtgtacttcacagccacattc
ccttacctcatgctggtggtcctgttaattcgaggggtgacgctgcctggggcagcccaa
ggaattcagttttatctgtacccaaacctcactcgtctgcgggatccccaggtgtggatg
gatgcgggcacccagatcttcttctccttcgctatctgtctagggtgcctgacggccctg
ggcagctacaacaagtaccacaacaactgctacagggactgcatggccctctgcttcctc
aacagtggcaccagctttgtggccgggtttgccatcttctccatcctgggcttcatgtcc
caagagcagggggtacccatctctgaggtggccgagtcaggtcctggcctggctttcatc
gcctacccccgggctgtggtgatgctgcccttctctcctctctgggcctgctgcttcttc
ttcatggtcgttctcctgggactagatagccagtttgtgtgcgtagagagcctggtgacg
gcgctggtggacatgtacccacatgtgtttcgtaagaagaatcggagggaggtcctcatc
cttggagtgtctgtcacctccttcctcctcgggctgatcatgctcacggagggtggtatg
tacgtgtttcagctctttgattactatgcagccagtggcatgtgcctcctgttcgtggca
atctttgagtccctctgtgtagcttgggtctatggagctgggcgcttctatgacaacatc
gaagatatgattgggtacaggccatggcctcttatcaaatattgttggctcttcctcaca
ccagctgtgtgcacagccaccttcctcttttccttgatcaagtacactccgctgacttac
aacaagaagtacacatacccctggtggggggacgcactgggctggctcctggctctgtcc
tccatggtctgcattcccgcctggagcttctacaagctcagcgccctcaaaggttccttc
agagagagaattcgccagcttgtgtgcccagctgaggacctgacccaacgggaccgagca
ggaccctctgcctctgctgcacccaggacagcgcttctcaggccaacagaactggagtct
cactgctag

DBGET integrated database retrieval system